RegulonDB RegulonDB 10.8: Gene Form
   

htpX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

prc yebQ htpX terminator TSS_2178 TSS_2178 TSS_2177 TSS_2177 htpXp htpXp TSS_2175 TSS_2175

Gene      
Name: htpX    Texpresso search in the literature
Synonym(s): ECK1828, EG10462, b1829
Genome position(nucleotides): 1911695 <-- 1912576 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.51
External database links:  
ASAP:
ABE-0006087
CGSC:
32320
ECHOBASE:
EB0457
OU-MICROARRAY:
b1829
PortEco:
htpX
STRING:
511145.b1829
COLOMBOS: htpX


Product      
Name: protease HtpX
Synonym(s): HtpX, zinc dependent endoprotease
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 31.923
Isoelectric point: 7.161
Motif(s):
 
Type Positions Sequence
34 -> 54 GLMIMALLFGFGGSFVSLLMS
73 -> 288 ERERWLVNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAVSTGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRILAQLAAGFMGGNRDEGEESNGNPLIYFAVATVLELVFGILASIITMWFSRHREFHADAGSAKLVGREKMIAALQRLKTSYEPQEATSMMALCINGKSKSLSELFMTHPPLDKRIEALRT
4 -> 24 IALFLLTNLAVMVVFGLVLSL
222 -> 222 E
226 -> 226 D

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.2 - temperature extremes
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
GO:0004222 - metalloendopeptidase activity
GO:0008237 - metallopeptidase activity
biological_process GO:0006508 - proteolysis
GO:0009266 - response to temperature stimulus
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
[IEP] Inferred from expression pattern
Reference(s): [1] Arolas JL., et al., 2014
[2] Kornitzer D., et al., 1991
[3] Sakoh M., et al., 2005
External database links:  
ECOCYC:
EG10462-MONOMER
ECOLIWIKI:
b1829
INTERPRO:
IPR001915
INTERPRO:
IPR022919
PFAM:
PF01435
PRIDE:
P23894
PROSITE:
PS00142
REFSEQ:
NP_416343
SMR:
P23894
UNIPROT:
P23894


Operon      
Name: htpX         
Operon arrangement:
Transcription unit        Promoter
htpX


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2175 1912259 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2177 1913805 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2178 1914229 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Arolas JL., Garcia-Castellanos R., Goulas T., Akiyama Y., Gomis-Ruth FX., 2014, Expression and purification of integral membrane metallopeptidase HtpX., Protein Expr Purif 99C:113-118

 [2] Kornitzer D., Teff D., Altuvia S., Oppenheim AB., 1991, Isolation, characterization, and sequence of an Escherichia coli heat shock gene, htpX., J Bacteriol 173(9):2944-53

 [3] Sakoh M., Ito K., Akiyama Y., 2005, Proteolytic activity of HtpX, a membrane-bound and stress-controlled protease from Escherichia coli., J Biol Chem 280(39):33305-10

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB