RegulonDB RegulonDB 10.9: Gene Form
   

argP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

scpA argP rpiA yqfE argK ArgP PhoB ArgP anti-anti-terminator anti-terminator terminator argPp argPp TSS_3206 TSS_3206 TSS_3205 (cluster) TSS_3205 (cluster) rpiAp rpiAp

Gene      
Name: argP    Texpresso search in the literature
Synonym(s): ECK2912, EG10490, b2916, iciA
Genome position(nucleotides): 3059753 --> 3060646 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.36
External database links:  
ASAP:
ABE-0009574
CGSC:
28646
ECHOBASE:
EB0485
ECOLIHUB:
argP
OU-MICROARRAY:
b2916
STRING:
511145.b2916
COLOMBOS: argP


Product      
Name: DNA-binding transcriptional dual regulator ArgP
Synonym(s): ArgP, IciA
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LysR
Cellular location: cytosol
Molecular weight: 33.472
Isoelectric point: 6.868
Motif(s):
 
Type Positions Sequence
21 -> 40 FERAAQKLCITQSAVSQRIK
4 -> 60 PDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENMFGQPLLVRTVPPRPT
7 -> 64 RTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENMFGQPLLVRTVPPRPTEQGQ
93 -> 288 LSLAVNADSLATWLLPALAPVLADSPIRLNLQVEDETRTQERLRRGEVVGAVSIQHQALPSCLVDKLGALDYLFVSSKPFAEKYFPNGVTRSALLKAPVVAFDHLDDMHQAFLQQNFDLPPGSVPCHIVNSSEAFVQLARQGTTCCMIPHLQIEKELASGELIDLTPGLFQRRMLYWHRFAPESRMMRKVTDALLD

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  2 - information transfer --> 2.3 - protein related --> 2.3.7 - nucleoproteins, basic proteins
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0003681 - bent DNA binding
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0032297 - negative regulation of DNA-dependent DNA replication initiation
Reference(s): [1] Han JS., et al., 1998
[2] Lee YS., et al., 1996
[3] Thony B., et al., 1991
External database links:  
DIP:
DIP-48015N
ECOCYC:
EG10490-MONOMER
ECOLIWIKI:
b2916
INTERPRO:
IPR017685
INTERPRO:
IPR023490
INTERPRO:
IPR005119
INTERPRO:
IPR036388
INTERPRO:
IPR036390
INTERPRO:
IPR000847
MODBASE:
P0A8S1
PFAM:
PF03466
PFAM:
PF00126
PRIDE:
P0A8S1
PRINTS:
PR00039
PRODB:
PRO_000022990
PROSITE:
PS50931
REFSEQ:
NP_417391
SMR:
P0A8S1
UNIPROT:
P0A8S1


Operon      
Name: argP         
Operon arrangement:
Transcription unit        Promoter
argP


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB
Repressed by: ArgP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3205 (cluster) 3059719 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_3206 3059729 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Han JS., Kwon HS., Yim JB., Hwang DS., 1998, Effect of IciA protein on the expression of the nrd gene encoding ribonucleoside diphosphate reductase in E. coli., Mol Gen Genet 259(6):610-4

 [2] Lee YS., Kim H., Hwang DS., 1996, Transcriptional activation of the dnaA gene encoding the initiator for oriC replication by IciA protein, an inhibitor of in vitro oriC replication in Escherichia coli., Mol Microbiol 19(2):389-96

 [3] Thony B., Hwang DS., Fradkin L., Kornberg A., 1991, iciA, an Escherichia coli gene encoding a specific inhibitor of chromosomal initiation of replication in vitro., Proc Natl Acad Sci U S A 88(10):4066-70

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB