RegulonDB RegulonDB 10.8: Gene Form
   

ilvB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ilvB ilvN ivbL anti-anti-terminator anti-terminator terminator anti-terminator

Gene      
Name: ilvB    Texpresso search in the literature
Synonym(s): ECK3662, EG10494, b3671
Genome position(nucleotides): 3851096 <-- 3852784 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.31
External database links:  
ASAP:
ABE-0011999
CGSC:
608
ECHOBASE:
EB0489
OU-MICROARRAY:
b3671
PortEco:
ilvB
STRING:
511145.b3671
COLOMBOS: ilvB


Product      
Name: acetohydroxy acid synthase I subunit IlvB
Synonym(s): IlvB, acetohydroxy acid synthase I, large subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 60.441
Isoelectric point: 5.194
Motif(s):
 
Type Positions Sequence
390 -> 538 DVGQHQMWTAQAYPLNRPRQWLTSGGLGTMGFGLPAAIGAALANPDRKVLCFSGDGSLMMNIQEMATASENQLDVKIILMNNEALGLVHQQQSLFYEQGVFAATYPGKINFMQIAAGFGLETCDLNNEADPQASLQEIINRPGPALIHV
264 -> 285 HGVRSTNYILQEADLLIVLGAR
14 -> 178 TGAEFIVHFLEQQGIKIVTGIPGGSILPVYDALSQSTQIRHILARHEQGAGFIAQGMARTDGKPAVCMACSGPGATNLVTAIADARLDSIPLICITGQVPASMIGTDAFQEVDTYGISIPITKHNYLVRHIEELPQVMSDAFRIAQSGRPGPVWIDIPKDVQTAV
201 -> 334 IRDAAAMINAAKRPVLYLGGGVINAPARVRELAEKAQLPTTMTLMALGMLPKAHPLSLGMLGMHGVRSTNYILQEADLLIVLGARFDDRAIGKTEQFCPNAKIIHVDIDRAELGKIKQPHVAIQADVDDVLAQL
393 -> 473 QHQMWTAQAYPLNRPRQWLTSGGLGTMGFGLPAAIGAALANPDRKVLCFSGDGSLMMNIQEMATASENQLDVKIILMNNEA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.18 - isoleucine/valine
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005948 - acetolactate synthase complex
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0050660 - flavin adenine dinucleotide binding
GO:0003984 - acetolactate synthase activity
GO:0000287 - magnesium ion binding
GO:0030976 - thiamine pyrophosphate binding
biological_process GO:0008652 - cellular amino acid biosynthetic process
GO:0009082 - branched-chain amino acid biosynthetic process
GO:0009099 - valine biosynthetic process
GO:0009097 - isoleucine biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10019N
ECOCYC:
LARGEILVB-MONOMER
ECOLIWIKI:
b3671
INTERPRO:
IPR012001
INTERPRO:
IPR039368
INTERPRO:
IPR029061
INTERPRO:
IPR029035
INTERPRO:
IPR012846
INTERPRO:
IPR012000
INTERPRO:
IPR011766
INTERPRO:
IPR000399
MINT:
MINT-1243593
MODBASE:
P08142
PANTHER:
PTHR18968:SF13
PFAM:
PF02776
PFAM:
PF02775
PFAM:
PF00205
PRIDE:
P08142
PRODB:
PRO_000023002
PROSITE:
PS00187
REFSEQ:
NP_418127
SMR:
P08142
UNIPROT:
P08142


Operon      
Name: ivbL-ilvBN-uhpABC         
Operon arrangement:
Transcription unit        Promoter
uhpB
ivbL
ivbL-ilvBN
ivbL-ilvBN-uhpABC
uhpABC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


RNA cis-regulatory element    
Attenuation: Transcriptional


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB