RegulonDB RegulonDB 10.9: Gene Form
   

ilvB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ilvB ilvN ivbL anti-anti-terminator anti-terminator terminator anti-terminator

Gene      
Name: ilvB    Texpresso search in the literature
Synonym(s): ECK3662, EG10494, b3671
Genome position(nucleotides): 3851096 <-- 3852784 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.31
External database links:  
ASAP:
ABE-0011999
CGSC:
608
ECHOBASE:
EB0489
ECOLIHUB:
ilvB
OU-MICROARRAY:
b3671
STRING:
511145.b3671
COLOMBOS: ilvB


Product      
Name: acetohydroxy acid synthase I subunit IlvB
Synonym(s): IlvB, acetohydroxy acid synthase I, large subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 60.441
Isoelectric point: 5.194
Motif(s):
 
Type Positions Sequence
390 -> 538 DVGQHQMWTAQAYPLNRPRQWLTSGGLGTMGFGLPAAIGAALANPDRKVLCFSGDGSLMMNIQEMATASENQLDVKIILMNNEALGLVHQQQSLFYEQGVFAATYPGKINFMQIAAGFGLETCDLNNEADPQASLQEIINRPGPALIHV
264 -> 285 HGVRSTNYILQEADLLIVLGAR
14 -> 178 TGAEFIVHFLEQQGIKIVTGIPGGSILPVYDALSQSTQIRHILARHEQGAGFIAQGMARTDGKPAVCMACSGPGATNLVTAIADARLDSIPLICITGQVPASMIGTDAFQEVDTYGISIPITKHNYLVRHIEELPQVMSDAFRIAQSGRPGPVWIDIPKDVQTAV
201 -> 334 IRDAAAMINAAKRPVLYLGGGVINAPARVRELAEKAQLPTTMTLMALGMLPKAHPLSLGMLGMHGVRSTNYILQEADLLIVLGARFDDRAIGKTEQFCPNAKIIHVDIDRAELGKIKQPHVAIQADVDDVLAQL
393 -> 473 QHQMWTAQAYPLNRPRQWLTSGGLGTMGFGLPAAIGAALANPDRKVLCFSGDGSLMMNIQEMATASENQLDVKIILMNNEA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.18 - isoleucine/valine
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005948 - acetolactate synthase complex
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0050660 - flavin adenine dinucleotide binding
GO:0003984 - acetolactate synthase activity
GO:0000287 - magnesium ion binding
GO:0030976 - thiamine pyrophosphate binding
biological_process GO:0008652 - cellular amino acid biosynthetic process
GO:0009082 - branched-chain amino acid biosynthetic process
GO:0009099 - valine biosynthetic process
GO:0009097 - isoleucine biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10019N
ECOCYC:
LARGEILVB-MONOMER
ECOLIWIKI:
b3671
INTERPRO:
IPR012846
INTERPRO:
IPR039368
INTERPRO:
IPR029061
INTERPRO:
IPR029035
INTERPRO:
IPR012001
INTERPRO:
IPR012000
INTERPRO:
IPR011766
INTERPRO:
IPR000399
MODBASE:
P08142
PFAM:
PF02775
PFAM:
PF02776
PFAM:
PF00205
PRIDE:
P08142
PRODB:
PRO_000023002
PROSITE:
PS00187
REFSEQ:
NP_418127
SMR:
P08142
UNIPROT:
P08142


Operon      
Name: ivbL-ilvBN-uhpABC         
Operon arrangement:
Transcription unit        Promoter
uhpB
ivbL
ivbL-ilvBN
ivbL-ilvBN-uhpABC
uhpABC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB