RegulonDB RegulonDB 10.9: Gene Form
   

ilvE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ilvD ilvE ilvM ilvG ilvAp ilvAp TSS_4395 TSS_4395 TSS_4394 TSS_4394 TSS_4393 TSS_4393 TSS_4392 TSS_4392 ilvEp3 ilvEp3

Gene      
Name: ilvE    Texpresso search in the literature
Synonym(s): ECK3762, EG10497, b3770
Genome position(nucleotides): 3952484 --> 3953413 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.95
External database links:  
ASAP:
ABE-0012316
CGSC:
605
ECHOBASE:
EB0492
ECOLIHUB:
ilvE
OU-MICROARRAY:
b3770
STRING:
511145.b3770
COLOMBOS: ilvE


Product      
Name: branched-chain-amino-acid aminotransferase
Synonym(s): IlvE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.094
Isoelectric point: 5.626
Motif(s):
 
Type Positions Sequence
2 -> 309 TTKKADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQRLHDSAKIYRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDVIIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQVLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGETEDKWGWLDQVNQ
36 -> 268 VFEGIRCYDSHKGPVVFRHREHMQRLHDSAKIYRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDVIIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQVLSRESLYLADEVFMSGTAAEITPVRSV
151 -> 151 A

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.17 - alanine
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.18 - isoleucine/valine
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.19 - leucine
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0008483 - transaminase activity
GO:0004084 - branched-chain-amino-acid transaminase activity
GO:0042802 - identical protein binding
GO:0052654 - L-leucine transaminase activity
GO:0052655 - L-valine transaminase activity
GO:0052656 - L-isoleucine transaminase activity
biological_process GO:0006532 - aspartate biosynthetic process
GO:0009081 - branched-chain amino acid metabolic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0009082 - branched-chain amino acid biosynthetic process
GO:0009098 - leucine biosynthetic process
GO:0009099 - valine biosynthetic process
GO:0009097 - isoleucine biosynthetic process
Reference(s): [1] Kuramitsu S., et al., 1985
External database links:  
DIP:
DIP-10022N
ECOCYC:
BRANCHED-CHAINAMINOTRANSFER-MONOMER
ECOLIWIKI:
b3770
INTERPRO:
IPR033939
INTERPRO:
IPR005785
INTERPRO:
IPR001544
INTERPRO:
IPR036038
INTERPRO:
IPR043131
INTERPRO:
IPR043132
INTERPRO:
IPR018300
PDB:
1IYE
PDB:
1IYD
PDB:
1I1M
PDB:
1I1L
PDB:
1I1K
PDB:
1A3G
PFAM:
PF01063
PRIDE:
P0AB80
PRODB:
PRO_000023005
PROSITE:
PS00770
REFSEQ:
YP_026247
SMR:
P0AB80
UNIPROT:
P0AB80


Operon      
Name: ilvLXGMEDA         
Operon arrangement:
Transcription unit        Promoter
ilvL
ilvLXG_1G_2MEDA
ilvL
ilvLXG_1G_2MEDA
ilvEDA
ilvA


Transcriptional Regulation      
Display Regulation             
Activated by: IHF
Repressed by: IHF, Lrp


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4392 3952390 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4393 3953336 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4394 3953347 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4395 3954417 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kuramitsu S., Ogawa T., Ogawa H., Kagamiyama H., 1985, Branched-chain amino acid aminotransferase of Escherichia coli: nucleotide sequence of the ilvE gene and the deduced amino acid sequence., J Biochem 97(4):993-9

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB