RegulonDB RegulonDB 10.9: Gene Form
   

ilvI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ilvI ilvH yabR Lrp Lrp Lrp ppGpp anti-terminator anti-anti-terminator terminator anti-terminator TSS_152 TSS_152 TSS_151 TSS_151 TSS_150 TSS_150 ilvIHp1 ilvIHp1 TSS_149 TSS_149 ilvIp2 ilvIp2

Gene      
Name: ilvI    Texpresso search in the literature
Synonym(s): ECK0079, EG10500, b0077
Genome position(nucleotides): 85630 --> 87354 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.93
Reference(s): [1] Haughn GW., et al., 1985
External database links:  
ASAP:
ABE-0000290
CGSC:
601
ECHOBASE:
EB0495
ECOLIHUB:
ilvI
OU-MICROARRAY:
b0077
STRING:
511145.b0077
COLOMBOS: ilvI


Product      
Name: acetolactate synthase / acetohydroxybutanoate synthase, catalytic subunit
Synonym(s): IlvI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 62.984
Isoelectric point: 6.287
Motif(s):
 
Type Positions Sequence
5 -> 168 SGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQAAVHMADGLARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVATSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPKDILNP
202 -> 203 TL
437 -> 438 LP
507 -> 509 LAE
196 -> 330 IKRALQTLVAAKKPVVYVGGGAITAGCHQQLKETVEALNLPVVCSLMGLGAFPATHRQALGMLGMHGTYEANMTMHNADVIFAVGVRFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVTADIPIVGDARQVLEQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.18 - isoleucine/valine
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005948 - acetolactate synthase complex
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0050660 - flavin adenine dinucleotide binding
GO:0003984 - acetolactate synthase activity
GO:0000287 - magnesium ion binding
GO:0030976 - thiamine pyrophosphate binding
biological_process GO:0008652 - cellular amino acid biosynthetic process
GO:0009082 - branched-chain amino acid biosynthetic process
GO:0009099 - valine biosynthetic process
GO:0009097 - isoleucine biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-6850N
ECOCYC:
ACETOLACTSYNIII-ICHAIN-MONOMER
ECOLIWIKI:
b0077
INTERPRO:
IPR012846
INTERPRO:
IPR039368
INTERPRO:
IPR029061
INTERPRO:
IPR029035
INTERPRO:
IPR012001
INTERPRO:
IPR012000
INTERPRO:
IPR011766
INTERPRO:
IPR000399
MODBASE:
P00893
PFAM:
PF02775
PFAM:
PF02776
PFAM:
PF00205
PRIDE:
P00893
PRODB:
PRO_000023008
PROSITE:
PS00187
REFSEQ:
YP_025294
SMR:
P00893
UNIPROT:
P00893


Operon      
Name: ilvIH         
Operon arrangement:
Transcription unit        Promoter
ilvIH
ilvIH
ilvIH
ilvIH


Transcriptional Regulation      
Display Regulation             
Activated by: Lrp
Repressed by: H-NS, Lrp


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_149 85599 forward nd [RS-EPT-CBR] [2]
  promoter TSS_150 86542 forward nd [RS-EPT-CBR] [2]
  promoter TSS_151 86559 forward nd [RS-EPT-CBR] [2]
  promoter TSS_152 87478 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Haughn GW., Squires CH., De Felice M., Largo CT., Calvo JM., 1985, Unusual organization of the ilvIH promoter of Escherichia coli., J Bacteriol 163(1):186-98

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB