RegulonDB RegulonDB 10.9: Gene Form
   

ilvM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ilvG ilvE ilvM ilvX Lrp TSS_4394 TSS_4394 TSS_4393 TSS_4393 TSS_4392 TSS_4392 ilvEp3 ilvEp3 TSS_4390 TSS_4390 TSS_4389 TSS_4389 TSS_4388 TSS_4388 TSS_4387 TSS_4387 TSS_4386 TSS_4386 TSS_4385 TSS_4385 TSS_4384 TSS_4384 TSS_4383 TSS_4383 TSS_4382 (cluster) TSS_4382 (cluster) TSS_4381 TSS_4381

Gene      
Name: ilvM    Texpresso search in the literature
Synonym(s): ECK3761, EG10501, b3769
Genome position(nucleotides): 3952201 --> 3952464 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.24
External database links:  
ASAP:
ABE-0012313
CGSC:
18214
ECHOBASE:
EB0496
ECOLIHUB:
ilvM
OU-MICROARRAY:
b3769
STRING:
511145.b3769
COLOMBOS: ilvM


Product      
Name: acetolactate synthase II subunit IlvM
Synonym(s): IlvM, acetolactate synthase / acetohydroxybutanoate synthase, regulatory subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.703
Isoelectric point: 8.843
Motif(s):
 
Type Positions Sequence
5 -> 78 QVNVSARFNPETLERVLRVVRHRGFHVCSMNMAAASDAQNINIELTVASPRSVDLLFSQLNKLVDVAHVAICQS
13 -> 73 NPETLERVLRVVRHRGFHVCSMNMAAASDAQNINIELTVASPRSVDLLFSQLNKLVDVAHV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.18 - isoleucine/valine
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0003984 - acetolactate synthase activity
biological_process GO:0008652 - cellular amino acid biosynthetic process
GO:0009082 - branched-chain amino acid biosynthetic process
GO:0009099 - valine biosynthetic process
GO:0009097 - isoleucine biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
SMALLILVM-MONOMER
ECOLIWIKI:
b3769
INTERPRO:
IPR002912
PFAM:
PF13710
PRIDE:
P0ADG1
PRODB:
PRO_000023009
PROSITE:
PS51671
REFSEQ:
NP_418217
UNIPROT:
P0ADG1


Operon      
Name: ilvLXGMEDA         
Operon arrangement:
Transcription unit        Promoter
ilvL
ilvLXG_1G_2MEDA
ilvL
ilvLXG_1G_2MEDA
ilvEDA
ilvA


Transcriptional Regulation      
Display Regulation             
Activated by: IHF
Repressed by: IHF, Lrp


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4381 3950511 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4382 (cluster) 3950539 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4383 3950564 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4384 3950727 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4385 3950822 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4386 3950842 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4387 3950850 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4388 3950867 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4389 3950982 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4390 3951887 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4392 3952390 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4393 3953336 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4394 3953347 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB