RegulonDB RegulonDB 10.8: Gene Form
   

infA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aat infA serW ppGpp anti-anti-terminator anti-terminator terminator terminator infAp1 infAp1 infAp2 infAp2 TSS_1056 TSS_1056 TSS_1055 TSS_1055 TSS_1054 TSS_1054 serWp1 serWp1 serWp2 serWp2 TSS_1053 TSS_1053

Gene      
Name: infA    Texpresso search in the literature
Synonym(s): ECK0875, EG10504, b0884, bypA1
Genome position(nucleotides): 926225 <-- 926443 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.4
External database links:  
ASAP:
ABE-0003005
CGSC:
17674
ECHOBASE:
EB0499
OU-MICROARRAY:
b0884
PortEco:
infA
STRING:
511145.b0884
COLOMBOS: infA


Product      
Name: translation initiation factor IF-1
Synonym(s): IF1, InfA, protein chain initiation factor IF-1
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 8.25
Isoelectric point: 9.765
Motif(s):
 
Type Positions Sequence
2 -> 72 AKEDNIEMQGTVLETLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIVFRSR
7 -> 70 IEMQGTVLETLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIVFR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0043022 - ribosome binding
GO:0003723 - RNA binding
GO:0003743 - translation initiation factor activity
GO:0019843 - rRNA binding
biological_process GO:0006412 - translation
GO:0006413 - translational initiation
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Dai Y., et al., 2017
External database links:  
DIP:
DIP-48250N
ECOCYC:
EG10504-MONOMER
ECOLIWIKI:
b0884
INTERPRO:
IPR022967
INTERPRO:
IPR004368
INTERPRO:
IPR012340
INTERPRO:
IPR006196
PANTHER:
PTHR33370
PDB:
1ZO1
PDB:
1AH9
PFAM:
PF01176
PRIDE:
P69222
PRODB:
PRO_000023012
PROSITE:
PS50832
REFSEQ:
NP_415404
SMART:
SM00316
SMR:
P69222
UNIPROT:
P69222


Operon      
Name: infA-serW         
Operon arrangement:
Transcription unit        Promoter
serW
serW
infA
infA
infA-serW


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1053 925971 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1054 926139 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1055 926361 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1056 926419 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Dai Y., Shortreed MR., Scalf M., Frey BL., Cesnik AJ., Solntsev S., Schaffer LV., Smith LM., 2017, Elucidating Escherichia coli Proteoform Families Using Intact-Mass Proteomics and a Global PTM Discovery Database., J Proteome Res 16(11):4156-4165

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB