RegulonDB RegulonDB 10.9: Gene Form
   

infC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

thrS infC rpmI DksA-ppGpp DksA-ppGpp DksA-ppGpp DksA-ppGpp DksA-ppGpp DksA-ppGpp anti-anti-terminator anti-terminator terminator TSS_2032 TSS_2032 TSS_2031 TSS_2031 TSS_2030 TSS_2030 TSS_2029 TSS_2029 infCp infCp TSS_2027 TSS_2027 TSS_2026 TSS_2026 TSS_2025 (cluster) TSS_2025 (cluster) TSS_2024 TSS_2024 infCp2 infCp2 TSS_2023 TSS_2023 TSS_2022 TSS_2022 TSS_2021 TSS_2021 rpmIp rpmIp TSS_2020 (cluster) TSS_2020 (cluster) TSS_2019 TSS_2019 TSS_2018 TSS_2018 TSS_2017 TSS_2017 TSS_2016 TSS_2016 TSS_2015 TSS_2015 TSS_2014 (cluster) TSS_2014 (cluster)

Gene      
Name: infC    Texpresso search in the literature
Synonym(s): ECK1716, EG10506, b1718, fit, srjA
Genome position(nucleotides): 1800096 <-- 1800638 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.62
External database links:  
ASAP:
ABE-0005734
CGSC:
596
ECHOBASE:
EB0501
ECOLIHUB:
infC
OU-MICROARRAY:
b1718
STRING:
511145.b1718
COLOMBOS: infC


Product      
Name: translation initiation factor IF-3
Synonym(s): Fit, IF3, InfC, SrjA, protein chain initiation factor IF-3
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.564
Isoelectric point: 10.204
Motif(s):
 
Type Positions Sequence
52 -> 52 D
161 -> 161 F
34 -> 36 LGI
178 -> 178 K
15 -> 84 INGEIRAQEVRLTGLEGEQLGIVSLREALEKAEEAGVDLVEISPNAEPPVCRIMDYGKFLYEKSKSSKEQ

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0043022 - ribosome binding
GO:0003723 - RNA binding
GO:0003743 - translation initiation factor activity
biological_process GO:0006412 - translation
GO:0006413 - translational initiation
GO:0009409 - response to cold
GO:0032790 - ribosome disassembly
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Haggerty TJ., et al., 1997
[2] Sabol S., et al., 1970
External database links:  
DIP:
DIP-36176N
DISPROT:
DP00197
ECOCYC:
EG10506-MONOMER
ECOLIWIKI:
b1718
INTERPRO:
IPR036787
INTERPRO:
IPR036788
INTERPRO:
IPR019815
INTERPRO:
IPR019814
INTERPRO:
IPR019813
INTERPRO:
IPR001288
MODBASE:
P0A707
PANTHER:
PTHR10938
PDB:
5ME0
PDB:
5ME1
PDB:
2IFE
PFAM:
PF00707
PFAM:
PF05198
PRIDE:
P0A707
PRODB:
PRO_000023014
PROSITE:
PS00938
REFSEQ:
NP_416233
SMR:
P0A707
SWISSMODEL:
P0A707
UNIPROT:
P0A707


Operon      
Name: thrS-infC-rpmI-rplT-pheMST-ihfA         
Operon arrangement:
Transcription unit        Promoter
ihfA
pheM
pheMST-ihfA
rplT
rplT-pheM
rpmI-rplT
infC-rpmI-rplT
infC
thrS-infC
thrS-infC-rpmI-rplT-pheMST-ihfA


Transcriptional Regulation      
Display Regulation             
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2014 (cluster) 1799992 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2015 1799997 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2016 1799999 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2017 1800003 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2018 1800005 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2019 1800009 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2020 (cluster) 1800331 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2021 1800430 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2022 1800596 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2023 1800817 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2024 1800819 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2025 (cluster) 1801170 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2026 1801273 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2027 1801278 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2029 1801426 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2030 1801552 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2031 1801633 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2032 1802563 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Haggerty TJ., Lovett ST., 1997, IF3-mediated suppression of a GUA initiation codon mutation in the recJ gene of Escherichia coli., J Bacteriol 179(21):6705-13

 [2] Sabol S., Sillero MA., Iwasaki K., Ochoa S., 1970, Purification and properties of initiation factor F3., Nature 228(5278):1269-73

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB