RegulonDB RegulonDB 10.9: Gene Form
   

katG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

katG yijE metF OxyR OxyR OxyR FNR FNR terminator anti-terminator anti-anti-terminator yijEp5 yijEp5 TSS_4651 TSS_4651 TSS_4650 TSS_4650 TSS_4649 TSS_4649 katGp katGp TSS_4648 TSS_4648 TSS_4647 TSS_4647 TSS_4646 TSS_4646 TSS_4645 (cluster) TSS_4645 (cluster)

Gene      
Name: katG    Texpresso search in the literature
Synonym(s): ECK3934, EG10511, b3942
Genome position(nucleotides): 4133835 --> 4136015 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.75
External database links:  
ASAP:
ABE-0012901
CGSC:
14983
ECHOBASE:
EB0506
ECOLIHUB:
katG
OU-MICROARRAY:
b3942
STRING:
511145.b3942
COLOMBOS: katG


Shine dalgarno      
Sequence: taacactgtaGAGGGGagcacattgATG


Product      
Name: catalase/hydroperoxidase HPI
Synonym(s): KatG, hydroperoxidase I
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 80.024
Isoelectric point: 4.927
Motif(s):
 
Type Positions Sequence
621 -> 621 A
78 -> 396 LKALLTESQPWWPADWGSYAGLFIRMAWHGAGTYRSIDGRGGAGRGQQRFAPLNSWPDNVSLDKARRLLWPIKQKYGQKISWADLFILAGNVALENSGFRTFGFGAGREDVWEPDLDVNWGDEKAWLTHRHPEALAKAPLGATEMGLIYVNPEGPDHSGEPLSAAAAIRATFGNMGMNDEETVALIAGGHTLGKTHGAGPTSNVGPDPEAAPIEEQGLGWASTYGSGVGADAITSGLEVVWTQTPTQWSNYFFENLFKYEWVQTRSPAGAIQFEAVDAPEIIPDPFDPSKKRKPTMLVTDLTLRFDPEFEKISRRFLND
403 -> 700 AFARAWFKLTHRDMGPKSRYIGPEVPKEDLIWQDPLPQPIYNPTEQDIIDLKFAIADSGLSVSELVSVAWASASTFRGGDKRGGANGARLALMPQRDWDVNAAAVRALPVLEKIQKESGKASLADIIVLAGVVGVEKAASAAGLSIHVPFAPGRVDARQDQTDIEMFELLEPIADGFRNYRARLDVSTTESLLIDKAQQLTLTAPEMTALVGGMRVLGANFDGSKNGVFTDRVGVLSNDFFVNLLDMRYEWKATDESKELFEGRDRETGEVKFTASRADLVFGSNSVLRAVAEVYASS

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0004601 - peroxidase activity
GO:0004096 - catalase activity
GO:0020037 - heme binding
GO:0042802 - identical protein binding
biological_process GO:0006979 - response to oxidative stress
GO:0042744 - hydrogen peroxide catabolic process
GO:0055114 - oxidation-reduction process
GO:0070301 - cellular response to hydrogen peroxide
GO:0098869 - cellular oxidant detoxification
Note(s): Note(s): ...[more].
Reference(s): [1] Abril N., et al., 1990
[2] Belkin S., et al., 1996
[3] Bowen SW., et al., 1988
[4] Gonzalez-Flecha B., et al., 1995
[5] Gonzalez-Flecha B., et al., 1997
[6] Hoerter JD., et al., 2005
[7] Hoerter JD., et al., 2005
[8] Imlay JA., et al., 1987
[9] Jung IL., et al., 2003
[10] Oktyabrsky ON., et al., 2001
[11] Poole RK., et al., 1986
[12] Powers L., et al., 2001
[13] Richter HE., et al., 1981
[14] Singh R., et al., 2008
[15] Tkachenko A., et al., 2001
[16] Triggs-Raine BL., et al., 1988
[17] Triggs-Raine BL., et al., 1987
[18] Zaid T., et al., 2003
External database links:  
DIP:
DIP-10053N
ECOCYC:
HYDROPEROXIDI-MONOMER
ECOLIWIKI:
b3942
INTERPRO:
IPR019793
INTERPRO:
IPR000763
INTERPRO:
IPR002016
INTERPRO:
IPR010255
INTERPRO:
IPR019794
MINT:
P13029
MODBASE:
P13029
PANTHER:
PTHR30555
PDB:
1U2L
PDB:
1U2K
PDB:
1U2J
PFAM:
PF00141
PRIDE:
P13029
PRINTS:
PR00460
PRINTS:
PR00458
PRODB:
PRO_000023043
PROSITE:
PS00436
PROSITE:
PS00435
PROSITE:
PS50873
REFSEQ:
NP_418377
SMR:
P13029
SWISSMODEL:
P13029
UNIPROT:
P13029


Operon      
Name: katG         
Operon arrangement:
Transcription unit        Promoter
katG


Transcriptional Regulation      
Display Regulation             
Activated by: Fur, FNR, OxyR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4645 (cluster) 4133788 forward For this promoter, there
Read more >
[RS-EPT-CBR] [19]
  promoter TSS_4646 4133795 forward nd [RS-EPT-CBR] [19]
  promoter TSS_4647 4133800 forward nd [RS-EPT-CBR] [19]
  promoter TSS_4648 4133810 forward nd [RS-EPT-CBR] [19]
  promoter TSS_4649 4133980 forward nd [RS-EPT-CBR] [19]
  promoter TSS_4650 4135811 forward nd [RS-EPT-CBR] [19]
  promoter TSS_4651 4136083 forward nd [RS-EPT-CBR] [19]
  promoter yijEp5 4136089 forward Similarity to the consensus
Read more >
[ICWHO] [20]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Abril N., Pueyo C., 1990, Mutagenesis in Escherichia coli lacking catalase., Environ Mol Mutagen 15(4):184-9

 [2] Belkin S., Smulski DR., Vollmer AC., Van Dyk TK., LaRossa RA., 1996, Oxidative stress detection with Escherichia coli harboring a katG'::lux fusion., Appl Environ Microbiol 62(7):2252-6

 [3] Bowen SW., Hassan HM., 1988, Induction of the manganese-containing superoxide dismutase in Escherichia coli is independent of the oxidative stress (oxyR-controlled) regulon., J Biol Chem 263(29):14808-11

 [4] Gonzalez-Flecha B., Demple B., 1995, Metabolic sources of hydrogen peroxide in aerobically growing Escherichia coli., J Biol Chem 270(23):13681-7

 [5] Gonzalez-Flecha B., Demple B., 1997, Homeostatic regulation of intracellular hydrogen peroxide concentration in aerobically growing Escherichia coli., J Bacteriol 179(2):382-8

 [6] Hoerter JD., Arnold AA., Kuczynska DA., Shibuya A., Ward CS., Sauer MG., Gizachew A., Hotchkiss TM., Fleming TJ., Johnson S., 2005, Effects of sublethal UVA irradiation on activity levels of oxidative defense enzymes and protein oxidation in Escherichia coli., J Photochem Photobiol B 81(3):171-80

 [7] Hoerter JD., Arnold AA., Ward CS., Sauer M., Johnson S., Fleming T., Eisenstark A., 2005, Reduced hydroperoxidase (HPI and HPII) activity in the Deltafur mutant contributes to increased sensitivity to UVA radiation in Escherichia coli., J Photochem Photobiol B 79(2):151-7

 [8] Imlay JA., Linn S., 1987, Mutagenesis and stress responses induced in Escherichia coli by hydrogen peroxide., J Bacteriol 169(7):2967-76

 [9] Jung IL., Kim IG., 2003, Transcription of ahpC, katG, and katE genes in Escherichia coli is regulated by polyamines: polyamine-deficient mutant sensitive to H2O2-induced oxidative damage., Biochem Biophys Res Commun 301(4):915-22

 [10] Oktyabrsky ON., Smirnovam GV., Muzyka NG., 2001, Role of glutathione in regulation of hydroperoxidase I in growing Escherichia coli., Free Radic Biol Med 31(2):250-5

 [11] Poole RK., Baines BS., Appleby CA., 1986, Haemoprotein b-590 (Escherichia coli), a reducible catalase and peroxidase: evidence for its close relationship to hydroperoxidase I and a 'cytochrome a1b' preparation., J Gen Microbiol 132(6):1525-39

 [12] Powers L., Hillar A., Loewen PC., 2001, Active site structure of the catalase-peroxidases from Mycobacterium tuberculosis and Escherichia coli by extended X-ray absorption fine structure analysis., Biochim Biophys Acta 1546(1):44-54

 [13] Richter HE., Loewen PC., 1981, Induction of catalase in Escherichia coli by ascorbic acid involves hydrogen peroxide., Biochem Biophys Res Commun 100(3):1039-46

 [14] Singh R., Wiseman B., Deemagarn T., Jha V., Switala J., Loewen PC., 2008, Comparative study of catalase-peroxidases (KatGs)., Arch Biochem Biophys 471(2):207-14

 [15] Tkachenko A., Nesterova L., Pshenichnov M., 2001, The role of the natural polyamine putrescine in defense against oxidative stress in Escherichia coli., Arch Microbiol 176(1-2):155-7

 [16] Triggs-Raine BL., Doble BW., Mulvey MR., Sorby PA., Loewen PC., 1988, Nucleotide sequence of katG, encoding catalase HPI of Escherichia coli., J Bacteriol 170(9):4415-9

 [17] Triggs-Raine BL., Loewen PC., 1987, Physical characterization of katG, encoding catalase HPI of Escherichia coli., Gene 52(2-3):121-8

 [18] Zaid T., Srikumar TS., Benov L., 2003, Growth of Escherichia coli in iron-enriched medium increases HPI catalase activity., J Biochem Mol Biol 36(6):608-10

 [19] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [20] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB