RegulonDB RegulonDB 10.9: Gene Form
   

leuS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

leuS lptE ybeL TSS_776 TSS_776 TSS_775 (cluster) TSS_775 (cluster) ybeLp ybeLp TSS_773 TSS_773 TSS_772 TSS_772 TSS_771 TSS_771 TSS_770 TSS_770 TSS_769 TSS_769 TSS_768 TSS_768 TSS_767 TSS_767 TSS_766 (cluster) TSS_766 (cluster) TSS_765 TSS_765 TSS_764 TSS_764

Gene      
Name: leuS    Texpresso search in the literature
Synonym(s): ECK0635, EG10532, b0642, syl
Genome position(nucleotides): 672201 <-- 674783 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.35
External database links:  
ASAP:
ABE-0002196
CGSC:
566
ECHOBASE:
EB0527
ECOLIHUB:
leuS
MIM:
615300
MIM:
617021
OU-MICROARRAY:
b0642
STRING:
511145.b0642
COLOMBOS: leuS


Product      
Name: leucine—tRNA ligase
Synonym(s): LeuRS, LeuS, Syl
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 97.234
Isoelectric point: 4.927
Motif(s):
 
Type Positions Sequence
15 -> 171 QLHWDEKRTFEVTEDESKEKYYCLSMLPYPSGRLHMGHVRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAVKNNTAPAPWTYDNIAYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYKKGLVYKKTSAVNWCPNDQTVLANEQV
221 -> 403 RNWIGRSEGVEITFNVNDYDNTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELAAFIDECRNTKVAEAEMATMEKKGVDTGFKAVHPLTGEEIPVWAANFVLMEYGTGAVMAVPGHDQRDYEFASKYGLNIKPVILAADGSEPDLSQQALTEKGVLFNSGEFNGLDHEAAFNAIADKL
196 -> 196 T
262 -> 262 A
417 -> 572 LRDWGVSRQRYWGAPIPMVTLEDGTVMPTPDDQLPVILPEDVVMDGITSPIKADPEWAKTTVNGMPALRETDTFDTFMESSWYYARYTCPQYKEGMLDSEAANYWLPVDIYIGGIEHAIMHLLYFRFFHKLMRDAGMVNSDEPAKQLLCQGMVLAD

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.1 - amino acid -activation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016874 - ligase activity
GO:0004812 - aminoacyl-tRNA ligase activity
GO:0000166 - nucleotide binding
GO:0004823 - leucine-tRNA ligase activity
GO:0005524 - ATP binding
GO:0002161 - aminoacyl-tRNA editing activity
biological_process GO:0106074 - aminoacyl-tRNA metabolism involved in translational fidelity
GO:0006412 - translation
GO:0006418 - tRNA aminoacylation for protein translation
GO:0006429 - leucyl-tRNA aminoacylation
Note(s): Note(s): ...[more].
Reference(s): [1] Brustad E., et al., 2008
[2] Jakubowski H. 1995
[3] Tan M., et al., 2012
External database links:  
DIP:
DIP-10095N
ECOCYC:
LEUS-MONOMER
ECOLIWIKI:
b0642
INTERPRO:
IPR009008
INTERPRO:
IPR002302
INTERPRO:
IPR002300
INTERPRO:
IPR025709
INTERPRO:
IPR009080
INTERPRO:
IPR013155
INTERPRO:
IPR014729
INTERPRO:
IPR001412
MODBASE:
P07813
PANTHER:
PTHR43740
PDB:
5ON3
PDB:
5ONH
PDB:
5ON2
PDB:
5OMW
PDB:
4CQN
PDB:
4AS1
PDB:
4ARI
PDB:
4ARC
PDB:
4AQ7
PDB:
3ZJV
PDB:
3ZJU
PDB:
3ZJT
PDB:
3ZGZ
PDB:
2AJI
PDB:
2AJH
PDB:
2AJG
PFAM:
PF13603
PFAM:
PF08264
PFAM:
PF00133
PRIDE:
P07813
PRINTS:
PR00985
PRODB:
PRO_000023086
PROSITE:
PS00178
REFSEQ:
NP_415175
SMR:
P07813
UNIPROT:
P07813


Operon      
Name: leuS-lptE-holA-nadD-cobC         
Operon arrangement:
Transcription unit        Promoter
leuS-lptE-holA-nadD-cobC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_764 673731 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_765 673832 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_766 (cluster) 674050 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_767 674222 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_768 674835 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_769 674845 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_770 674922 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_771 674937 forward nd [RS-EPT-CBR] [4]
  promoter TSS_772 674941 forward nd [RS-EPT-CBR] [4]
  promoter TSS_773 674976 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_775 (cluster) 674996 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_776 675001 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Brustad E., Bushey ML., Brock A., Chittuluru J., Schultz PG., 2008, A promiscuous aminoacyl-tRNA synthetase that incorporates cysteine, methionine, and alanine homologs into proteins., Bioorg Med Chem Lett 18(22):6004-6

 [2] Jakubowski H., 1995, Proofreading in vivo. Editing of homocysteine by aminoacyl-tRNA synthetases in Escherichia coli., J Biol Chem 270(30):17672-3

 [3] Tan M., Yan W., Liu RJ., Wang M., Chen X., Zhou XL., Wang ED., 2012, A naturally occurring nonapeptide functionally compensates for the CP1 domain of leucyl-tRNA synthetase to modulate aminoacylation activity., Biochem J 443(2):477-84

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB