RegulonDB RegulonDB 10.8: Gene Form
   

leuS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

leuS lptE ybeL TSS_776 TSS_776 TSS_775 (cluster) TSS_775 (cluster) ybeLp ybeLp TSS_773 TSS_773 TSS_772 TSS_772 TSS_771 TSS_771 TSS_770 TSS_770 TSS_769 TSS_769 TSS_768 TSS_768 TSS_767 TSS_767 TSS_766 (cluster) TSS_766 (cluster) TSS_765 TSS_765 TSS_764 TSS_764

Gene      
Name: leuS    Texpresso search in the literature
Synonym(s): ECK0635, EG10532, b0642, syl
Genome position(nucleotides): 672201 <-- 674783 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.35
External database links:  
ASAP:
ABE-0002196
CGSC:
566
ECHOBASE:
EB0527
MIM:
615300
MIM:
617021
OU-MICROARRAY:
b0642
PortEco:
leuS
STRING:
511145.b0642
COLOMBOS: leuS


Product      
Name: leucine—tRNA ligase
Synonym(s): LeuRS, LeuS, Syl
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 97.234
Isoelectric point: 4.927
Motif(s):
 
Type Positions Sequence
618 -> 651 SKMSKSKNNGIDPQVMVERYGADTVRLFMMFASP
15 -> 171 QLHWDEKRTFEVTEDESKEKYYCLSMLPYPSGRLHMGHVRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAVKNNTAPAPWTYDNIAYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYKKGLVYKKTSAVNWCPNDQTVLANEQV
221 -> 403 RNWIGRSEGVEITFNVNDYDNTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELAAFIDECRNTKVAEAEMATMEKKGVDTGFKAVHPLTGEEIPVWAANFVLMEYGTGAVMAVPGHDQRDYEFASKYGLNIKPVILAADGSEPDLSQQALTEKGVLFNSGEFNGLDHEAAFNAIADKL
196 -> 196 T
262 -> 262 A

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.1 - amino acid -activation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016874 - ligase activity
GO:0004812 - aminoacyl-tRNA ligase activity
GO:0000166 - nucleotide binding
GO:0004823 - leucine-tRNA ligase activity
GO:0005524 - ATP binding
GO:0002161 - aminoacyl-tRNA editing activity
biological_process GO:0106074 - aminoacyl-tRNA metabolism involved in translational fidelity
GO:0006412 - translation
GO:0006418 - tRNA aminoacylation for protein translation
GO:0006429 - leucyl-tRNA aminoacylation
Note(s): Note(s): ...[more].
Reference(s): [1] Brustad E., et al., 2008
[2] Jakubowski H. 1995
[3] Tan M., et al., 2012
External database links:  
DIP:
DIP-10095N
ECOCYC:
LEUS-MONOMER
ECOLIWIKI:
b0642
INTERPRO:
IPR001412
INTERPRO:
IPR009080
INTERPRO:
IPR025709
INTERPRO:
IPR002302
INTERPRO:
IPR009008
INTERPRO:
IPR002300
INTERPRO:
IPR013155
INTERPRO:
IPR014729
MINT:
MINT-1226410
MODBASE:
P07813
PANTHER:
PTHR43740
PDB:
5ONH
PDB:
5ON3
PDB:
5ON2
PDB:
4CQN
PDB:
4AS1
PDB:
4ARI
PDB:
4ARC
PDB:
4AQ7
PDB:
3ZJV
PDB:
3ZJU
PDB:
3ZJT
PDB:
3ZGZ
PDB:
2AJI
PDB:
2AJH
PDB:
2AJG
PDB:
5OMW
PFAM:
PF00133
PFAM:
PF13603
PFAM:
PF08264
PRIDE:
P07813
PRINTS:
PR00985
PRODB:
PRO_000023086
PROSITE:
PS00178
REFSEQ:
NP_415175
SMR:
P07813
UNIPROT:
P07813


Operon      
Name: leuS-lptE-holA-nadD-cobC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_764 673731 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_765 673832 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_766 (cluster) 674050 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_767 674222 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_768 674835 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_769 674845 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_770 674922 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_771 674937 forward nd [RS-EPT-CBR] [4]
  promoter TSS_772 674941 forward nd [RS-EPT-CBR] [4]
  promoter TSS_773 674976 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_775 (cluster) 674996 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_776 675001 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Brustad E., Bushey ML., Brock A., Chittuluru J., Schultz PG., 2008, A promiscuous aminoacyl-tRNA synthetase that incorporates cysteine, methionine, and alanine homologs into proteins., Bioorg Med Chem Lett 18(22):6004-6

 [2] Jakubowski H., 1995, Proofreading in vivo. Editing of homocysteine by aminoacyl-tRNA synthetases in Escherichia coli., J Biol Chem 270(30):17672-3

 [3] Tan M., Yan W., Liu RJ., Wang M., Chen X., Zhou XL., Wang ED., 2012, A naturally occurring nonapeptide functionally compensates for the CP1 domain of leucyl-tRNA synthetase to modulate aminoacylation activity., Biochem J 443(2):477-84

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB