RegulonDB RegulonDB 10.8: Gene Form
   

lit gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

intE lit ymfE xisE litp9 litp9 litp8 litp8 litp1 litp1 ymfDp7 ymfDp7 ymfDp5 ymfDp5 ymfDp6 ymfDp6

Gene      
Name: lit    Texpresso search in the literature
Synonym(s): ECK1125, EG10535, b1139
Genome position(nucleotides): 1198695 --> 1199588 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
36.8
External database links:  
ASAP:
ABE-0003834
CGSC:
554
ECHOBASE:
EB0530
OU-MICROARRAY:
b1139
PortEco:
lit
STRING:
511145.b1139
COLOMBOS: lit


Product      
Name: e14 prophage; cell death peptidase Lit
Synonym(s): Lit, Lit, cell death peptidase; phage exclusion
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 33.762
Isoelectric point: 5.995
Motif(s):
 
Type Positions Sequence
121 -> 135 TGCESWPKKCPKPEA
61 -> 82 IVLTVASLEYIWAFSNFFWVFT
149 -> 178 IFLCAIAWILHHEISHVVLQHPLVTTAFST

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.4 - proteases, cleavage of compounds
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
biological_process GO:0006508 - proteolysis
GO:0006448 - regulation of translational elongation
Note(s): Note(s): ...[more].
Reference(s): [1] Gottesman S. 1998
External database links:  
ECOCYC:
EG10535-MONOMER
ECOLIWIKI:
b1139
INTERPRO:
IPR019504
PFAM:
PF10463
PRIDE:
P11072
REFSEQ:
NP_415657
SMR:
P11072
UNIPROT:
P11072


Operon      
Name: lit         
Operon arrangement:
Transcription unit        Promoter
lit


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ymfDp6 1197589 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ymfDp5 1197625 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ymfDp7 1197661 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter litp1 1198516 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter litp8 1198590 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter litp9 1198668 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Gottesman S., 1998, Protecting the neighborhood: extreme measures., Proc Natl Acad Sci U S A 95(6):2731-2

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB