RegulonDB RegulonDB 10.8: Gene Form
   

livJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

livJ rpoH panZ Lrp GcvB DksA-ppGpp DksA-ppGpp ppGpp livJp livJp TSS_4063 (cluster) TSS_4063 (cluster) TSS_4062 TSS_4062

Gene      
Name: livJ    Texpresso search in the literature
Synonym(s): ECK3444, EG10539, b3460, hrbB, hrbC, hrbD
Genome position(nucleotides): 3598555 <-- 3599658 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.44
Reference(s): [1] Adams MD., et al., 1990
External database links:  
ASAP:
ABE-0011299
CGSC:
551
ECHOBASE:
EB0534
OU-MICROARRAY:
b3460
PortEco:
livJ
STRING:
511145.b3460
COLOMBOS: livJ


Product      
Name: branched chain amino acid/phenylalanine ABC transporter periplasmic binding protein
Synonym(s): HrbB, HrbC, HrbD, LIV-I BP, LivJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 39.076
Isoelectric point: 5.486
Motif(s):
 
Type Positions Sequence
12 -> 12 C
24 -> 367 EDIKVAVVGAMSGPVAQYGDQEFTGAEQAVADINAKGGIKGNKLQIVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYQLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGEGLARAVQDGLKKGNANVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDDPAEIAKYLKANSVDTVMGPLTWDEKGDLKGFEFGVFDWHANGTATDAK
1 -> 23 MNIKGKALLAGCIALAFSNMALA
3 -> 3 I
16 -> 16 A

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.18 - isoleucine/valine
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.19 - leucine
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
biological_process GO:0006865 - amino acid transport
GO:0015803 - branched-chain amino acid transport
GO:0015820 - leucine transport
GO:0015829 - valine transport
GO:0015818 - isoleucine transport
Note(s): Note(s): ...[more].
Reference(s): [2] Antonucci TK., et al., 1985
External database links:  
ECOCYC:
LIVJ-MONOMER
ECOLIWIKI:
b3460
INTERPRO:
IPR028081
INTERPRO:
IPR028082
INTERPRO:
IPR000709
MODBASE:
P0AD96
PANTHER:
PTHR30483:SF16
PDB:
2LIV
PDB:
1Z17
PDB:
1Z16
PDB:
1Z15
PDB:
1Z18
PFAM:
PF13458
PRIDE:
P0AD96
PRINTS:
PR00337
PRODB:
PRO_000023097
REFSEQ:
YP_026223
SMR:
P0AD96
SWISSMODEL:
P0AD96
UNIPROT:
P0AD96


Operon      
Name: livJ         
Operon arrangement:
Transcription unit        Promoter
livJ


Transcriptional Regulation      
Display Regulation             
Repressed by: Lrp


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4062 3599692 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4063 (cluster) 3599761 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Adams MD., Wagner LM., Graddis TJ., Landick R., Antonucci TK., Gibson AL., Oxender DL., 1990, Nucleotide sequence and genetic characterization reveal six essential genes for the LIV-I and LS transport systems of Escherichia coli., J Biol Chem 265(20):11436-43

 [2] Antonucci TK., Landick R., Oxender DL., 1985, The leucine binding proteins of Escherichia coli as models for studying the relationships between protein structure and function., J Cell Biochem 29(3):209-16

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB