RegulonDB RegulonDB 10.9: Gene Form
   

livJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

livJ rpoH panZ Lrp GcvB DksA-ppGpp DksA-ppGpp ppGpp livJp livJp TSS_4063 (cluster) TSS_4063 (cluster) TSS_4062 TSS_4062

Gene      
Name: livJ    Texpresso search in the literature
Synonym(s): ECK3444, EG10539, b3460, hrbB, hrbC, hrbD
Genome position(nucleotides): 3598555 <-- 3599658 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.44
Reference(s): [1] Adams MD., et al., 1990
External database links:  
ASAP:
ABE-0011299
CGSC:
551
ECHOBASE:
EB0534
ECOLIHUB:
livJ
OU-MICROARRAY:
b3460
STRING:
511145.b3460
COLOMBOS: livJ


Product      
Name: branched chain amino acid/phenylalanine ABC transporter periplasmic binding protein
Synonym(s): HrbB, HrbC, HrbD, LIV-I BP, LivJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 39.076
Isoelectric point: 5.486
Motif(s):
 
Type Positions Sequence
12 -> 12 C
26 -> 345 IKVAVVGAMSGPVAQYGDQEFTGAEQAVADINAKGGIKGNKLQIVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYQLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGEGLARAVQDGLKKGNANVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDDPAEIAKYLKANSVDTVMGPLTWDEKG
24 -> 367 EDIKVAVVGAMSGPVAQYGDQEFTGAEQAVADINAKGGIKGNKLQIVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYQLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGEGLARAVQDGLKKGNANVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDDPAEIAKYLKANSVDTVMGPLTWDEKGDLKGFEFGVFDWHANGTATDAK
1 -> 23 MNIKGKALLAGCIALAFSNMALA
3 -> 3 I

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.18 - isoleucine/valine
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.19 - leucine
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
biological_process GO:0006865 - amino acid transport
GO:0015803 - branched-chain amino acid transport
GO:0015820 - leucine transport
GO:0015829 - valine transport
GO:0015818 - isoleucine transport
Note(s): Note(s): ...[more].
Reference(s): [2] Antonucci TK., et al., 1985
External database links:  
ECOCYC:
LIVJ-MONOMER
ECOLIWIKI:
b3460
INTERPRO:
IPR028082
INTERPRO:
IPR028081
INTERPRO:
IPR000709
MODBASE:
P0AD96
PDB:
1Z18
PDB:
2LIV
PDB:
1Z17
PDB:
1Z16
PDB:
1Z15
PFAM:
PF13458
PRIDE:
P0AD96
PRINTS:
PR00337
PRODB:
PRO_000023097
REFSEQ:
YP_026223
SMR:
P0AD96
SWISSMODEL:
P0AD96
UNIPROT:
P0AD96


Operon      
Name: livJ         
Operon arrangement:
Transcription unit        Promoter
livJ


Transcriptional Regulation      
Display Regulation             
Repressed by: Lrp


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4062 3599692 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4063 (cluster) 3599761 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Adams MD., Wagner LM., Graddis TJ., Landick R., Antonucci TK., Gibson AL., Oxender DL., 1990, Nucleotide sequence and genetic characterization reveal six essential genes for the LIV-I and LS transport systems of Escherichia coli., J Biol Chem 265(20):11436-43

 [2] Antonucci TK., Landick R., Oxender DL., 1985, The leucine binding proteins of Escherichia coli as models for studying the relationships between protein structure and function., J Cell Biochem 29(3):209-16

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB