RegulonDB RegulonDB 10.9: Gene Form
   

livK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

livK livH panZ livM GcvB panZp7 panZp7 panZp1 panZp1 livKp1 livKp1 livKp2 livKp2 TSS_4060 (cluster) TSS_4060 (cluster) TSS_4059 TSS_4059 TSS_4058 TSS_4058

Gene      
Name: livK    Texpresso search in the literature
Synonym(s): ECK3442, EG10540, b3458, hrbB, hrbC, hrbD
Genome position(nucleotides): 3596451 <-- 3597560 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.14
External database links:  
ASAP:
ABE-0011292
CGSC:
550
ECHOBASE:
EB0535
ECOLIHUB:
livK
OU-MICROARRAY:
b3458
STRING:
511145.b3458
COLOMBOS: livK


Shine dalgarno      
Sequence: acatcacgaaTGGGGAtttttgacTAT


Product      
Name: L-leucine/L-phenylalanine ABC transporter periplasmic binding protein
Synonym(s): HrbB, HrbC, HrbD, LS-BP, LivK
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 39.379
Isoelectric point: 5.461
Motif(s):
 
Type Positions Sequence
3 -> 3 R
1 -> 23 MKRNAKTIIAGMIALAISHTAMA
24 -> 369 DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTAAK
26 -> 363 IKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADG
41 -> 41 W

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.19 - leucine
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0070728 - leucine binding
biological_process GO:0006865 - amino acid transport
GO:0015820 - leucine transport
Note(s): Note(s): ...[more].
Reference(s): [1] Adams MD., et al., 1991
[2] Adams MD., et al., 1991
[3] Antonucci TK., et al., 1985
[4] Furlong CE., et al., 1970
[5] Landick R., et al., 1984
[6] Salopek-Sondi B., et al., 2002
[7] Zhou Y., et al., 2020
External database links:  
ECOCYC:
LIVK-MONOMER
ECOLIWIKI:
b3458
INTERPRO:
IPR000709
INTERPRO:
IPR028081
INTERPRO:
IPR028082
MODBASE:
P04816
PDB:
2LBP
PDB:
1USK
PDB:
1USI
PDB:
1USG
PFAM:
PF13458
PRIDE:
P04816
PRINTS:
PR00337
PRODB:
PRO_000023098
REFSEQ:
NP_417915
SMR:
P04816
UNIPROT:
P04816


Operon      
Name: livKHMGF         
Operon arrangement:
Transcription unit        Promoter
livKHMGF
livKHMGF


Transcriptional Regulation      
Display Regulation             
Repressed by: Lrp


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4058 3596577 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_4059 3597615 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_4060 (cluster) 3597723 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter panZp1 3597828 forward Similarity to the consensus
Read more >
[ICWHO] [9]
  promoter panZp7 3597958 forward Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [8], [9]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Adams MD., Maguire DJ., Oxender DL., 1991, Altering the binding activity and specificity of the leucine binding proteins of Escherichia coli., J Biol Chem 266(10):6209-14

 [2] Adams MD., Oxender DL., 1991, Secretion of mutant leucine-specific binding proteins with internal deletions in Escherichia coli., J Cell Biochem 46(4):321-30

 [3] Antonucci TK., Landick R., Oxender DL., 1985, The leucine binding proteins of Escherichia coli as models for studying the relationships between protein structure and function., J Cell Biochem 29(3):209-16

 [4] Furlong CE., Weiner JH., 1970, Purification of a leucine-specific binding protein from Escherichia coli., Biochem Biophys Res Commun 38(6):1076-83

 [5] Landick R., Duncan JR., Copeland BR., Nazos PM., Oxender DL., 1984, Secretion and degradation of mutant leucine-specific binding protein molecules containing C-terminal deletions., J Cell Biochem 24(4):331-44

 [6] Salopek-Sondi B., Luck LA., 2002, 19F NMR study of the leucine-specific binding protein of Escherichia coli: mutagenesis and assignment of the 5-fluorotryptophan-labeled residues., Protein Eng 15(11):855-9

 [7] Zhou Y., Imlay JA., 2020, Escherichia coli K-12 Lacks a High-Affinity Assimilatory Cysteine Importer., mBio 11(3)

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [9] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB