RegulonDB RegulonDB 10.8: Gene Form
   

livK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

livK livH panZ livM GcvB panZp7 panZp7 panZp1 panZp1 livKp1 livKp1 livKp2 livKp2 TSS_4060 (cluster) TSS_4060 (cluster) TSS_4059 TSS_4059 TSS_4058 TSS_4058

Gene      
Name: livK    Texpresso search in the literature
Synonym(s): ECK3442, EG10540, b3458, hrbB, hrbC, hrbD
Genome position(nucleotides): 3596451 <-- 3597560 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.14
External database links:  
ASAP:
ABE-0011292
CGSC:
550
ECHOBASE:
EB0535
OU-MICROARRAY:
b3458
PortEco:
livK
STRING:
511145.b3458
COLOMBOS: livK


Shine dalgarno      
Sequence: acatcacgaaTGGGGAtttttgacTAT


Product      
Name: L-leucine/L-phenylalanine ABC transporter periplasmic binding protein
Synonym(s): HrbB, HrbC, HrbD, LS-BP, LivK
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 39.379
Isoelectric point: 5.461
Motif(s):
 
Type Positions Sequence
3 -> 3 R
1 -> 23 MKRNAKTIIAGMIALAISHTAMA
24 -> 369 DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTAAK
26 -> 363 IKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADG
41 -> 41 W

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.19 - leucine
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0070728 - leucine binding
biological_process GO:0006865 - amino acid transport
GO:0015820 - leucine transport
Note(s): Note(s): ...[more].
Reference(s): [1] Adams MD., et al., 1991
[2] Adams MD., et al., 1991
[3] Antonucci TK., et al., 1985
[4] Furlong CE., et al., 1970
[5] Landick R., et al., 1984
[6] Salopek-Sondi B., et al., 2002
External database links:  
ECOCYC:
LIVK-MONOMER
ECOLIWIKI:
b3458
INTERPRO:
IPR000709
INTERPRO:
IPR028081
INTERPRO:
IPR028082
MODBASE:
P04816
PANTHER:
PTHR30483:SF16
PDB:
1USK
PDB:
1USI
PDB:
1USG
PDB:
2LBP
PFAM:
PF13458
PRIDE:
P04816
PRINTS:
PR00337
PRODB:
PRO_000023098
REFSEQ:
NP_417915
SMR:
P04816
UNIPROT:
P04816


Operon      
Name: livKHMGF         
Operon arrangement:
Transcription unit        Promoter
livKHMGF
livKHMGF


Transcriptional Regulation      
Display Regulation             
Repressed by: Lrp


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4058 3596577 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_4059 3597615 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_4060 (cluster) 3597723 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter panZp1 3597828 forward Similarity to the consensus
Read more >
[ICWHO] [8]
  promoter panZp7 3597958 forward Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [7], [8]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Adams MD., Maguire DJ., Oxender DL., 1991, Altering the binding activity and specificity of the leucine binding proteins of Escherichia coli., J Biol Chem 266(10):6209-14

 [2] Adams MD., Oxender DL., 1991, Secretion of mutant leucine-specific binding proteins with internal deletions in Escherichia coli., J Cell Biochem 46(4):321-30

 [3] Antonucci TK., Landick R., Oxender DL., 1985, The leucine binding proteins of Escherichia coli as models for studying the relationships between protein structure and function., J Cell Biochem 29(3):209-16

 [4] Furlong CE., Weiner JH., 1970, Purification of a leucine-specific binding protein from Escherichia coli., Biochem Biophys Res Commun 38(6):1076-83

 [5] Landick R., Duncan JR., Copeland BR., Nazos PM., Oxender DL., 1984, Secretion and degradation of mutant leucine-specific binding protein molecules containing C-terminal deletions., J Cell Biochem 24(4):331-44

 [6] Salopek-Sondi B., Luck LA., 2002, 19F NMR study of the leucine-specific binding protein of Escherichia coli: mutagenesis and assignment of the 5-fluorotryptophan-labeled residues., Protein Eng 15(11):855-9

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [8] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB