RegulonDB RegulonDB 10.9: Gene Form
   

lon gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lon hupB sraA CpxR CpxR CpxR Fis CRP Fis Fis Fis anti-anti-terminator terminator terminator anti-terminator TSS_605 TSS_605 TSS_604 (cluster) TSS_604 (cluster) TSS_603 TSS_603 TSS_602 TSS_602 TSS_601 TSS_601 TSS_600 TSS_600 TSS_599 TSS_599 hupBp1 hupBp1 TSS_598 TSS_598 TSS_597 (cluster) TSS_597 (cluster) TSS_596 (cluster) TSS_596 (cluster) TSS_595 (cluster) TSS_595 (cluster) hupBp2 hupBp2 TSS_593 TSS_593 TSS_592 TSS_592 hupBp3 hupBp3 hupBp4 hupBp4 TSS_590 TSS_590 TSS_589 TSS_589 lonp lonp TSS_587 TSS_587 TSS_586 TSS_586 TSS_585 TSS_585 TSS_584 TSS_584

Gene      
Name: lon    Texpresso search in the literature
Synonym(s): ECK0433, EG10542, b0439, capR, deg, dir, lopA, muc
Genome position(nucleotides): 458888 --> 461242 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.31
External database links:  
ASAP:
ABE-0001521
CGSC:
547
ECHOBASE:
EB0537
ECOLIHUB:
lon
MIM:
600373
OU-MICROARRAY:
b0439
STRING:
511145.b0439
COLOMBOS: lon


Product      
Name: Lon protease
Synonym(s): CapR, DNA-binding, ATP-dependent protease La, Deg, Dir, Lon, LopA, Muc
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 87.438
Isoelectric point: 6.313
Motif(s):
 
Type Positions Sequence
2 -> 784 NPERSERIEIPVLPLRDVVVYPHMVIPLFVGREKSIRCLEAAMDHDKKIMLVAQKEASTDEPGVNDLFTVGTVASILQMLKLPDGTVKVLVEGLQRARISALSDNGEHFSAKAEYLESPTIDEREQEVLVRTAISQFEGYIKLNKKIPPEVLTSLNSIDDPARLADTIAAHMPLKLADKQSVLEMSDVNERLEYLMAMMESEIDLLQVEKRIRNRVKKQMEKSQREYYLNEQMKAIQKELGEMDDAPDENEALKRKIDAAKMPKEAKEKAEAELQKLKMMSPMSAEATVVRGYIDWMVQVPWNARSKVKKDLRQAQEILDTDHYGLERVKDRILEYLAVQSRVNKIKGPILCLVGPPGVGKTSLGQSIAKATGRKYVRMALGGVRDEAEIRGHRRTYIGSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEVLDPEQNVAFSDHYLEVDYDLSDVMFVATSNSMNIPAPLLDRMEVIRLSGYTEDEKLNIAKRHLLPKQIERNALKKGELTVDDSAIIGIIRYYTREAGVRGLEREISKLCRKAVKQLLLDKSLKHIEINGDNLHDYLGVQRFDYGRADNENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEPSGMQVVTAK
307 -> 307 S
539 -> 563 AGVRGLEREISKLCRKAVKQLLLDK
570 -> 772 INGDNLHDYLGVQRFDYGRADNENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQ
240 -> 252 ELGEMDDAPDENE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  2 - information transfer --> 2.3 - protein related --> 2.3.6 - turnover, degradation
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.4 - proteases, cleavage of compounds
  5 - cell processes --> 5.1 - cell division
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
  8 - extrachromosomal --> 8.2 - plasmid related
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004176 - ATP-dependent peptidase activity
GO:0004252 - serine-type endopeptidase activity
GO:0008236 - serine-type peptidase activity
GO:0043565 - sequence-specific DNA binding
GO:0042802 - identical protein binding
biological_process GO:0010165 - response to X-ray
GO:0006508 - proteolysis
GO:0006515 - protein quality control for misfolded or incompletely synthesized proteins
GO:0009408 - response to heat
GO:0030163 - protein catabolic process
GO:0034605 - cellular response to heat
Reference(s): [1] Sargentini NJ., et al., 2016
External database links:  
DIP:
DIP-35845N
ECOCYC:
EG10542-MONOMER
ECOLIWIKI:
b0439
ECOO157CYC:
LON-MONOMER
INTERPRO:
IPR020568
INTERPRO:
IPR027065
INTERPRO:
IPR027417
INTERPRO:
IPR015947
INTERPRO:
IPR027543
INTERPRO:
IPR014721
INTERPRO:
IPR008269
INTERPRO:
IPR003111
INTERPRO:
IPR003593
INTERPRO:
IPR003959
INTERPRO:
IPR004815
INTERPRO:
IPR008268
MINT:
P0A9M0
MODBASE:
P0A9M0
PANTHER:
PTHR10046
PDB:
6N2I
PDB:
3LJC
PDB:
2ANE
PDB:
1RRE
PDB:
1RR9
PDB:
1QZM
PFAM:
PF02190
PFAM:
PF05362
PFAM:
PF00004
PRIDE:
P0A9M0
PRODB:
PRO_000023108
PROSITE:
PS51786
PROSITE:
PS51787
PROSITE:
PS01046
REFSEQ:
NP_414973
SMART:
SM00464
SMART:
SM00382
SMR:
P0A9M0
UNIPROT:
P0A9M0


Operon      
Name: clpPX-lon         
Operon arrangement:
Transcription unit        Promoter
clpPX
clpPX
clpPX
clpX-lon
lon
lon


Transcriptional Regulation      
Display Regulation             
Activated by: GadX


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_584 458768 forward nd [RS-EPT-CBR] [2]
  promoter TSS_585 458780 forward nd [RS-EPT-CBR] [2]
  promoter TSS_586 458803 forward nd [RS-EPT-CBR] [2]
  promoter TSS_587 458809 forward nd [RS-EPT-CBR] [2]
  promoter TSS_589 458867 forward nd [RS-EPT-CBR] [2]
  promoter TSS_590 458974 forward nd [RS-EPT-CBR] [2]
  promoter TSS_592 461391 forward nd [RS-EPT-CBR] [2]
  promoter TSS_593 461393 forward nd [RS-EPT-CBR] [2]
  promoter TSS_595 (cluster) 461430 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_596 (cluster) 461433 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_597 (cluster) 461436 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_598 461441 forward nd [RS-EPT-CBR] [2]
  promoter TSS_599 461445 forward nd [RS-EPT-CBR] [2]
  promoter TSS_600 461451 forward nd [RS-EPT-CBR] [2]
  promoter TSS_601 461455 forward nd [RS-EPT-CBR] [2]
  promoter TSS_602 461459 forward nd [RS-EPT-CBR] [2]
  promoter TSS_603 461478 forward nd [RS-EPT-CBR] [2]
  promoter TSS_604 (cluster) 461543 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_605 461552 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Sargentini NJ., Gularte NP., Hudman DA., 2016, Screen for genes involved in radiation survival of Escherichia coli and construction of a reference database., Mutat Res 793-794:1-14

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB