RegulonDB RegulonDB 10.9: Gene Form
   

lysC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pgi lysC yjbD SoxS Cis-reg; riboswitch terminator TSS_4871 TSS_4871 TSS_4870 TSS_4870 TSS_4869 TSS_4869 TSS_4868 TSS_4868 TSS_4867 (cluster) TSS_4867 (cluster) TSS_4866 (cluster) TSS_4866 (cluster) TSS_4865 TSS_4865 TSS_4864 TSS_4864 TSS_4863 TSS_4863 pgip pgip lysCp2 lysCp2 lysCp1 lysCp1 TSS_4862 TSS_4862 TSS_4861 TSS_4861 TSS_4860 TSS_4860 TSS_4859 TSS_4859 TSS_4858 TSS_4858 TSS_4857 TSS_4857 TSS_4856 TSS_4856 TSS_4855 TSS_4855 TSS_4854 TSS_4854 TSS_4853 TSS_4853 TSS_4852 (cluster) TSS_4852 (cluster) TSS_4851 TSS_4851 TSS_4850 TSS_4850 TSS_4849 TSS_4849 TSS_4848 TSS_4848 TSS_4847 TSS_4847

Gene      
Name: lysC    Texpresso search in the literature
Synonym(s): ECK4016, EG10550, apk, b4024
Genome position(nucleotides): 4231884 <-- 4233233 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.85
External database links:  
ASAP:
ABE-0013156
CGSC:
539
ECHOBASE:
EB0545
ECOLIHUB:
lysC
OU-MICROARRAY:
b4024
STRING:
511145.b4024
COLOMBOS: lysC


Product      
Name: aspartate kinase III
Synonym(s): Apk, LysC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 48.532
Isoelectric point: 4.749
Motif(s):
 
Type Positions Sequence
14 -> 15 VA
20 -> 20 M
345 -> 346 SE
246 -> 449 AEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFRALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTSTGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICYGASSHNLCFLVPGEDAEQVVQKLHSNLFE
324 -> 325 FL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.21 - homoserine
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.7 - lysine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004072 - aspartate kinase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0008152 - metabolic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0009085 - lysine biosynthetic process
GO:0009089 - lysine biosynthetic process via diaminopimelate
GO:0009090 - homoserine biosynthetic process
GO:0016310 - phosphorylation
External database links:  
ECOCYC:
ASPKINIII-MONOMER
ECOLIWIKI:
b4024
INTERPRO:
IPR041745
INTERPRO:
IPR001048
INTERPRO:
IPR042199
INTERPRO:
IPR036393
INTERPRO:
IPR001341
INTERPRO:
IPR002912
INTERPRO:
IPR005260
INTERPRO:
IPR018042
MODBASE:
P08660
PDB:
2J0X
PDB:
2J0W
PFAM:
PF00696
PFAM:
PF01842
PRIDE:
P08660
PRODB:
PRO_000023138
PROSITE:
PS51671
PROSITE:
PS00324
REFSEQ:
NP_418448
SMR:
P08660
UNIPROT:
P08660


Operon      
Name: lysC         
Operon arrangement:
Transcription unit        Promoter
lysC
lysC


Transcriptional Regulation      
Display Regulation             
Activated by: ArgP


RNA cis-regulatory element    
   
Cis-reg; riboswitch Lysine riboswitch
   
   


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4847 4233084 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4848 4233093 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4849 4233095 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4850 4233097 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4851 4233099 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4852 (cluster) 4233115 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4853 4233120 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4854 4233132 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4855 4233151 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4856 4233231 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4857 4233233 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4858 4233235 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4859 4233254 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4860 4233281 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4861 4233289 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4862 4233537 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4863 4233952 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4864 4233960 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4865 4234102 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4866 (cluster) 4234157 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4867 (cluster) 4234160 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4868 4234163 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4869 4234180 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4870 4234624 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4871 4235143 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB