RegulonDB RegulonDB 11.0: Gene Form
   

malG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

malF xylE malG malH CRP XylR XylR TSS_4874 TSS_4874 TSS_4873 TSS_4873 TSS_4872 TSS_4872 xylEp xylEp xylEp1 xylEp1 xylEp8 xylEp8

Gene      
Name: malG    Texpresso search in the literature
Synonym(s): ECK4024, EG10556, b4032
Genome position(nucleotides): 4242626 <-- 4243516
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.55
External database links:  
ASAP:
ABE-0013193
CGSC:
530
ECHOBASE:
EB0551
ECOLIHUB:
malG
OU-MICROARRAY:
b4032
STRING:
511145.b4032
COLOMBOS: malG


Product      
Name: maltose ABC transporter membrane subunit MalG
Synonym(s): MalG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 32.225
Isoelectric point: 9.282
Motif(s):
 
Type Positions Sequence Comment
18 -> 37 LLLLLFIAAIMFPLLMVVAI
19 -> 39 LLLLFIAAIMFPLLMVVAISL UniProt: Helical.
81 -> 102 VLLWLWNSVKVAGISAIGIVAL
82 -> 102 LLWLWNSVKVAGISAIGIVAL UniProt: Helical.
85 -> 281 LWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVALYALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLLA UniProt: ABC transmembrane type-1.

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:1990154 - enzyme IIA-maltose transporter complex
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
GO:1990060 - maltose transport complex
molecular_function GO:0005515 - protein binding
GO:0015423 - ABC-type maltose transporter activity
biological_process GO:1904981 - maltose transmembrane transport
GO:1902344 - negative regulation of maltose transport
GO:0008643 - carbohydrate transport
GO:0015768 - maltose transport
GO:0042956 - maltodextrin transport
GO:0055085 - transmembrane transport
GO:0034763 - negative regulation of transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Boyd D., et al., 1993
[2] Nelson BD., et al., 1998
External database links:  
ALPHAFOLD:
P68183
DIP:
DIP-59709N
ECOCYC:
MALG-MONOMER
ECOLIWIKI:
b4032
INTERPRO:
IPR000515
INTERPRO:
IPR035906
PDB:
2r6g
PDB:
3FH6
PDB:
4KI0
PDB:
4JBW
PDB:
3RLF
PDB:
3PV0
PDB:
3PUZ
PDB:
3PUY
PDB:
3PUV
PDB:
3PUW
PDB:
3PUX
PFAM:
PF00528
PRIDE:
P68183
PRODB:
PRO_000023149
PROSITE:
PS50928
REFSEQ:
NP_418456
SMR:
P68183
UNIPROT:
P68183


Operon      
Name: malEFGH         
Operon arrangement:
Transcription unit        Promoter
malEFGH


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, H-NS, MalT, Fis, StpA
Repressed by: CreB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter xylEp8 4242260 reverse nd [ICWHO] [3]
  promoter xylEp1 4242270 reverse nd [ICWHO] [3]
  promoter TSS_4872 4242704 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4873 4242731 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4874 4242830 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Boyd D., Traxler B., Beckwith J., 1993, Analysis of the topology of a membrane protein by using a minimum number of alkaline phosphatase fusions., J Bacteriol 175(2):553-6

 [2] Nelson BD., Traxler B., 1998, Exploring the role of integral membrane proteins in ATP-binding cassette transporters: analysis of a collection of MalG insertion mutants., J Bacteriol 180(9):2507-14

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB