RegulonDB RegulonDB 10.9: Gene Form
   

malM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjbI lamB malM ubiC FNR IHF TSS_4876 TSS_4876 ubiCp ubiCp

Gene      
Name: malM    Texpresso search in the literature
Synonym(s): ECK4029, EG10559, b4037, molA
Genome position(nucleotides): 4249554 --> 4250474 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.42
External database links:  
ASAP:
ABE-0013221
CGSC:
18178
ECHOBASE:
EB0554
ECOLIHUB:
malM
OU-MICROARRAY:
b4037
STRING:
511145.b4037
COLOMBOS: malM


Product      
Name: maltose regulon periplasmic protein
Synonym(s): MalM, MolA
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 31.943
Isoelectric point: 8.375
Motif(s):
 
Type Positions Sequence
76 -> 209 ISGPVAAYSVPANIGELTLTLTSEVNKQTSVFAPNVLILDQNMTPSAFFPSSYFTYQEPGVMSADRLEGVMRLTPALGQQKLYVLVFTTEKDLQQTTQLLDPAKAYAKGVGNSIPDIPDPVARHTTDGLLKLKV
23 -> 306 ISLADVNYVPQNTSDAPAIPSAALQQLTWTPVDQSKTQTTQLATGGQQLNVPGISGPVAAYSVPANIGELTLTLTSEVNKQTSVFAPNVLILDQNMTPSAFFPSSYFTYQEPGVMSADRLEGVMRLTPALGQQKLYVLVFTTEKDLQQTTQLLDPAKAYAKGVGNSIPDIPDPVARHTTDGLLKLKVKTNSSSSVLVGPLFGSSAPAPVTVGNTAAPAVAAPAPAPVKKSEPMLNDTESYFNTAIKNAVAKGDVDKALKLLDEAERLGSTSARSTFISSVKGKG
1 -> 22 MKMNKSLIVLCLSAGLLASAPG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
biological_process GO:0008643 - carbohydrate transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10145N
ECOCYC:
EG10559-MONOMER
ECOLIWIKI:
b4037
INTERPRO:
IPR010794
PFAM:
PF07148
PRIDE:
P03841
REFSEQ:
NP_418461
UNIPROT:
P03841


Operon      
Name: malK-lamB-malM         
Operon arrangement:
Transcription unit        Promoter
malK-lamB-malM


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, MalT


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4876 4252748 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB