RegulonDB RegulonDB 11.0: Gene Form
   

mazE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

relA mazG mazF mazE Fis MazE-MazF MazE MazE MazE-MazF ppGpp terminator TSS_3086 TSS_3086 TSS_3085 TSS_3085 mazEp1 mazEp1 mazEp2 mazEp2 mazGp4 mazGp4

Gene      
Name: mazE    Texpresso search in the literature
Synonym(s): ECK2777, EG10571, b2783, chpAI, chpR
Genome position(nucleotides): 2911091 <-- 2911339
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.59
External database links:  
ASAP:
ABE-0009122
CGSC:
33283
ECHOBASE:
EB0566
ECOLIHUB:
chpR
OU-MICROARRAY:
b2783
STRING:
511145.b2783
COLOMBOS: mazE


Product      
Name: antitoxin of the MazF-MazE toxin-antitoxin system MazE
Synonym(s): ChpAI, ChpR, MazE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.356
Isoelectric point: 4.469
Motif(s):
 
Type Positions Sequence Comment
4 -> 49 SSVKRWGNSPAVRIPATLMQALNLNIDDEVKIDLVDGKLIIEPVRK UniProt: SpoVT-AbrB.
7 -> 51 KRWGNSPAVRIPATLMQALNLNIDDEVKIDLVDGKLIIEPVRKEP
8 -> 8 R UniProt: Binds poorly to DNA..
16 -> 16 R UniProt: Does not bind to DNA..

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.10 - defense/survival
  5 - cell processes --> 5.5 - adaptations --> 5.5.3 - starvation
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
Gene Ontology Terms (GO)  
cellular_component GO:0110001 - toxin-antitoxin complex
GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003690 - double-stranded DNA binding
GO:0042803 - protein homodimerization activity
GO:0044877 - protein-containing complex binding
GO:0097351 - toxin sequestering activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0040008 - regulation of growth
GO:0044010 - single-species biofilm formation
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P0AE72
DISPROT:
DP01291
ECOCYC:
EG10571-MONOMER
ECOLIWIKI:
b2783
INTERPRO:
IPR007159
INTERPRO:
IPR037914
MODBASE:
P0AE72
PANTHER:
PTHR40516
PDB:
1UB4
PDB:
5CQY
PDB:
5CQX
PDB:
2MRU
PDB:
2MRN
PDB:
1MVF
PFAM:
PF04014
PRIDE:
P0AE72
PRODB:
PRO_000022285
PROSITE:
PS51740
REFSEQ:
NP_417263
SMART:
SM00966
SMR:
P0AE72
SWISSMODEL:
P0AE72
UNIPROT:
P0AE72


Operon      
Name: relA-mazEFG         
Operon arrangement:
Transcription unit        Promoter
mazEFG
mazEFG
relA
relA-mazEF
relA-mazEF
relA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, H-NS, Fis
Repressed by: HipAB, MazE, MazE-MazF, HipB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter mazGp4 2910860 reverse nd [ICWHO] [1]
  promoter TSS_3085 2913146 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3086 2913158 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB