RegulonDB RegulonDB 10.9: Gene Form
   

mcrA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mcrA pinE iraM icdC mcrAp9 mcrAp9 mcrAp8 mcrAp8 mcrAp10 mcrAp10 mcrAp7 mcrAp7

Gene      
Name: mcrA    Texpresso search in the literature
Synonym(s): ECK1145, EG10573, b1159, rglA
Genome position(nucleotides): 1210346 --> 1211179 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
38.37
External database links:  
ASAP:
ABE-0003891
CGSC:
10961
ECHOBASE:
EB0568
ECOLIHUB:
mcrA
OU-MICROARRAY:
b1159
STRING:
511145.b1159
COLOMBOS: mcrA


Product      
Name: e14 prophage; 5-methylcytosine-specific restriction enzyme McrA
Synonym(s): EcoKMcrA, McrA, RglA, restriction of DNA at 5-methylcytosine residues
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.39
Isoelectric point: 7.497
Motif(s):
 
Type Positions Sequence
214 -> 214 A
207 -> 257 CENCGKNAPFYLNDGNPYLEVHHVIPLSSGGADTTDNCVALCPNCHRELHY

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0004518 - nuclease activity
GO:0004519 - endonuclease activity
GO:0016787 - hydrolase activity
GO:0008327 - methyl-CpG binding
biological_process GO:0009307 - DNA restriction-modification system
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
Note(s): Note(s): ...[more].
Reference(s): [1] Czapinska H., et al., 2018
[2] Mulligan EA., et al., 2010
[3] Raleigh EA., et al., 1989
[4] Slyvka A., et al., 2019
External database links:  
ECOCYC:
EG10573-MONOMER
ECOLIWIKI:
b1159
INTERPRO:
IPR002711
INTERPRO:
IPR003615
PDB:
6T22
PDB:
6T21
PDB:
6R64
PDB:
6GHC
PFAM:
PF01844
PRIDE:
P24200
PRODB:
PRO_000023170
REFSEQ:
NP_415677
SMART:
SM00507
SMR:
P24200
UNIPROT:
P24200


Operon      
Name: mcrA         
Operon arrangement:
Transcription unit        Promoter
mcrA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter mcrAp7 1210139 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter mcrAp10 1210195 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter mcrAp8 1210319 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter mcrAp9 1210323 forward Similarity to the consensus
Read more >
[ICWHO] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Czapinska H., Kowalska M., Zagorskaite E., Manakova E., Slyvka A., Xu SY., Siksnys V., Sasnauskas G., Bochtler M., 2018, Activity and structure of EcoKMcrA., Nucleic Acids Res 46(18):9829-9841

 [2] Mulligan EA., Hatchwell E., McCorkle SR., Dunn JJ., 2010, Differential binding of Escherichia coli McrA protein to DNA sequences that contain the dinucleotide m5CpG., Nucleic Acids Res 38(6):1997-2005

 [3] Raleigh EA., Trimarchi R., Revel H., 1989, Genetic and physical mapping of the mcrA (rglA) and mcrB (rglB) loci of Escherichia coli K-12., Genetics 122(2):279-96

 [4] Slyvka A., Zagorskaite E., Czapinska H., Sasnauskas G., Bochtler M., 2019, Crystal structure of the EcoKMcrA N-terminal domain (NEco): recognition of modified cytosine bases without flipping., Nucleic Acids Res 47(22):11943-11955

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB