RegulonDB RegulonDB 10.9: Gene Form
   

melA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

melB melA melR MelR MelR CRP MelR MelR CRP MelR terminator melAp melAp melRp melRp TSS_4922 TSS_4922

Gene      
Name: melA    Texpresso search in the literature
Synonym(s): ECK4112, EG10577, b4119, mel-7
Genome position(nucleotides): 4341911 --> 4343266 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.43
External database links:  
ASAP:
ABE-0013493
CGSC:
522
ECHOBASE:
EB0572
ECOLIHUB:
melA
OU-MICROARRAY:
b4119
STRING:
511145.b4119
COLOMBOS: melA


Product      
Name: α-galactosidase
Synonym(s): MelA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 50.657
Isoelectric point: 5.677
Motif(s):
 
Type Positions Sequence
5 -> 71 PKITFIGAGSTIFVKNILGDVFHREALKTAHIALMDIDPTRLEESHIVVRKLMDSAGASGKITCHTQ
6 -> 188 KITFIGAGSTIFVKNILGDVFHREALKTAHIALMDIDPTRLEESHIVVRKLMDSAGASGKITCHTQQKEALEDADFVVVAFQIGGYEPCTVTDFEVCKRHGLEQTIADTLGPGGIMRALRTIPHLWQICEDMTEVCPDATMLNYVNPMAMNTWAMYARYPHIKQVGLCHSVQGTAEELARDLN
198 -> 421 CAGINHMAFYLELERKTADGSYVNLYPELLAAYEAGQAPKPNIHGNTRCQNIVRYEMFKKLGYFVTESSEHFAEYTPWFIKPGREDLIERYKVPLDEYPKRCVEQLANWHKELEEYKKASRIDIKPSREYASTIMNAIWTGEPSVIYGNVRNDGLIDNLPQGCCVEVACLVDANGIQPTKVGTLPSHLAALMQTNINVQTLLTEAILTENRDRVYHAAMMDPHT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0004557 - alpha-galactosidase activity
GO:0030145 - manganese ion binding
GO:0070403 - NAD+ binding
GO:0052692 - raffinose alpha-galactosidase activity
biological_process GO:0008152 - metabolic process
GO:0005975 - carbohydrate metabolic process
GO:0055114 - oxidation-reduction process
GO:0005995 - melibiose catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Liljestrom PL., et al., 1987
External database links:  
CAZY:
GH4
DIP:
DIP-10179N
ECOCYC:
ALPHAGALACTOSID-MONOMER
ECOLIWIKI:
b4119
INTERPRO:
IPR036291
INTERPRO:
IPR001088
INTERPRO:
IPR015955
INTERPRO:
IPR019802
INTERPRO:
IPR022616
MODBASE:
P06720
PANTHER:
PTHR32092
PFAM:
PF11975
PFAM:
PF02056
PRIDE:
P06720
PRINTS:
PR00732
PRODB:
PRO_000023197
PROSITE:
PS01324
REFSEQ:
NP_418543
SMR:
P06720
UNIPROT:
P06720


Operon      
Name: melAB         
Operon arrangement:
Transcription unit        Promoter
melAB


Transcriptional Regulation      
Display Regulation             
Activated by: MelR, CRP
Repressed by: MelR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4922 4340855 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Liljestrom PL., Liljestrom P., 1987, Nucleotide sequence of the melA gene, coding for alpha-galactosidase in Escherichia coli K-12., Nucleic Acids Res 15(5):2213-20

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB