RegulonDB RegulonDB 10.9: Gene Form
   

metJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

metB yiiX metJ PhoP MetJ MetJ MetJ MetJ MetJ MetJ Fur TSS_4644 TSS_4644 TSS_4643 TSS_4643 metBp metBp TSS_4642 TSS_4642 metJp1 metJp1 metJp2 metJp2 metJp3 metJp3

Gene      
Name: metJ    Texpresso search in the literature
Synonym(s): ECK3930, EG10588, b3938
Genome position(nucleotides): 4128078 <-- 4128395 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.89
External database links:  
ASAP:
ABE-0012874
CGSC:
508
ECHOBASE:
EB0583
ECOLIHUB:
metJ
OU-MICROARRAY:
b3938
STRING:
511145.b3938
COLOMBOS: metJ


Shine dalgarno      
Sequence: acgaagaggaTTAAGTatctCAT


Product      
Name: DNA-binding transcriptional repressor MetJ
Synonym(s): MetJ
Sequence: Get amino acid sequence Fasta Format
Regulator Family: MetJ
Cellular location: cytosol
Molecular weight: 12.141
Isoelectric point: 5.245
Motif(s):
 
Type Positions Sequence
2 -> 105 AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY
3 -> 99 EWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGIN
61 -> 61 A
57 -> 57 L

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.9 - methionine
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0002055 - adenine binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0006555 - methionine metabolic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0009086 - methionine biosynthetic process
GO:0045892 - negative regulation of transcription, DNA-templated
External database links:  
DIP:
DIP-47929N
ECOCYC:
PD04032
ECOLIWIKI:
b3938
INTERPRO:
IPR023453
INTERPRO:
IPR002084
INTERPRO:
IPR010985
PDB:
1CMA
PDB:
1MJP
PDB:
1MJQ
PDB:
1CMB
PDB:
1CMC
PDB:
1MJ2
PDB:
1MJK
PDB:
1MJL
PDB:
1MJM
PDB:
1MJO
PFAM:
PF01340
PRIDE:
P0A8U6
PRODB:
PRO_000023215
REFSEQ:
NP_418373
SMR:
P0A8U6
UNIPROT:
P0A8U6


Operon      
Name: metJ         
Operon arrangement:
Transcription unit        Promoter
metJ
metJ
metJ


Transcriptional Regulation      
Display Regulation             
Repressed by: Fur
Growth Conditions:

[1] 

C: Escherichia coli| minimal medium| amino acids 50 µg; glucose 0.2%; thiamine 1 µg/mL| 32.0 C| exponential phase
E: Escherichia coli| minimal medium| amino acids 50 µg; glucose 0.2%; methionine 200 µg/mL; thiamine 1 µg/mL| 32.0 C| exponential phase

[2] 

C: Escherichia coli| MOPS| amino acids 50 µg; glucose 0.2%; thiamine 1 µg/mL| 32.0 C| exponential phase
E: Escherichia coli| MOPS| amino acids 50 µg; cadmium dichloride 600 µM; glucose 0.2%; thiamine 1 µg/mL| 32.0 C| exponential phase



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4642 4128635 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4643 4129260 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4644 4129519 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muńiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB