RegulonDB RegulonDB 10.9: Gene Form
   

msbA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycaI msbA ycaQ lpxK TSS_1189 TSS_1189

Gene      
Name: msbA    Texpresso search in the literature
Synonym(s): ECK0905, EG10613, b0914
Genome position(nucleotides): 966621 --> 968369 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.89
External database links:  
ASAP:
ABE-0003113
CGSC:
31743
ECHOBASE:
EB0608
ECOLIHUB:
msbA
MIM:
612244
OU-MICROARRAY:
b0914
STRING:
511145.b0914
COLOMBOS: msbA


Product      
Name: ATP-binding lipopolysaccharide transport protein
Synonym(s): MsbA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 64.461
Isoelectric point: 8.873
Motif(s):
 
Type Positions Sequence
270 -> 270 A
501 -> 519 ILILDEATSALDTESERAI
63 -> 83 VLVWMPLVVIGLMILRGITSY
481 -> 484 LSGG
223 -> 272 QEVETKRFDKVSNRMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASF

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016887 - ATPase activity
GO:0042626 - ATPase-coupled transmembrane transporter activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015437 - lipopolysaccharide floppase activity
GO:0008289 - lipid binding
GO:0008144 - drug binding
GO:0008559 - ATPase-coupled xenobiotic transmembrane transporter activity
GO:0042802 - identical protein binding
GO:0034040 - ATPase-coupled lipid transmembrane transporter activity
biological_process GO:0015920 - lipopolysaccharide transport
GO:0006869 - lipid transport
GO:0055085 - transmembrane transport
GO:0034204 - lipid translocation
GO:0042908 - xenobiotic transport
Note(s): Note(s): ...[more].
Reference(s): [1] Campbell JD., et al., 2003
[2] Chang G., et al., 2006
[3] Davidson AL., et al., 2005
[4] Doerrler WT. 2007
[5] Eckford PD., et al., 2010
[6] Fujishima H., et al., 2002
[7] Haubertin DY., et al., 2006
[8] Higgins CF., et al., 2001
[9] Miller G. 2006
[10] Mittal A., et al., 2012
[11] Reyes CL., et al., 2005
[12] Reyes CL., et al., 2005
[13] Schmitt L. 2002
[14] Schultz KM., et al., 2011
[15] Shilling RA., et al., 2003
[16] Siarheyeva A., et al., 2009
[17] Thomas PJ., et al., 2001
[18] Wang X., et al., 2004
[19] Ward A., et al., 2007
[20] Woebking B., et al., 2008
[21] Zgurskaya HI. 2002
External database links:  
DIP:
DIP-36229N
ECOCYC:
EG10613-MONOMER
ECOLIWIKI:
b0914
INTERPRO:
IPR003593
INTERPRO:
IPR036640
INTERPRO:
IPR003439
INTERPRO:
IPR039421
INTERPRO:
IPR011527
INTERPRO:
IPR011917
INTERPRO:
IPR017871
INTERPRO:
IPR027417
MODBASE:
P60752
PANTHER:
PTHR24221
PDB:
3B5W
PFAM:
PF00005
PFAM:
PF00664
PRIDE:
P60752
PRODB:
PRO_000023294
PROSITE:
PS51239
PROSITE:
PS50929
PROSITE:
PS50893
PROSITE:
PS00211
REFSEQ:
NP_415434
SMART:
SM00382
SMR:
P60752
UNIPROT:
P60752


Operon      
Name: ycaI-msbA-lpxK-ycaQ         
Operon arrangement:
Transcription unit        Promoter
ycaI-msbA-lpxK-ycaQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1189 966594 forward nd [RS-EPT-CBR] [22]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Campbell JD., Biggin PC., Baaden M., Sansom MS., 2003, Extending the structure of an ABC transporter to atomic resolution: modeling and simulation studies of MsbA., Biochemistry 42(13):3666-73

 [2] Chang G., Roth CB., Reyes CL., Pornillos O., Chen YJ., Chen AP., 2006, Retraction., Science 314(5807):1875

 [3] Davidson AL., Chen J., 2005, Structural biology. Flipping lipids: is the third time the charm?, Science 308(5724):963-5

 [4] Doerrler WT., 2007, Density gradient enrichment of Escherichia coli conditional msbA mutants., Appl Environ Microbiol 73(24):7992-6

 [5] Eckford PD., Sharom FJ., 2010, The reconstituted Escherichia coli MsbA protein displays lipid flippase activity., Biochem J 429(1):195-203

 [6] Fujishima H., Nishimura A., Wachi M., Takagi H., Hirasawa T., Teraoka H., Nishimori K., Kawabata T., Nishikawa K., Nagai K., 2002, kdsA mutations affect FtsZ-ring formation in Escherichia coli K-12., Microbiology 148(Pt 1):103-12

 [7] Haubertin DY., Madaoui H., Sanson A., Guerois R., Orlowski S., 2006, Molecular dynamics simulations of E. coli MsbA transmembrane domain: formation of a semipore structure., Biophys J 91(7):2517-31

 [8] Higgins CF., Linton KJ., 2001, Structural biology. The xyz of ABC transporters., Science 293(5536):1782-4

 [9] Miller G., 2006, Scientific publishing. A scientist's nightmare: software problem leads to five retractions., Science 314(5807):1856-7

 [10] Mittal A., Bohm S., Grutter MG., Bordignon E., Seeger MA., 2012, Asymmetry in the homodimeric ABC transporter MsbA recognized by a DARPin., J Biol Chem 287(24):20395-406

 [11] Reyes CL., Chang G., 2005, Structure of the ABC transporter MsbA in complex with ADP.vanadate and lipopolysaccharide., Science 308(5724):1028-31

 [12] Reyes CL., Chang G., 2005, Lipopolysaccharide stabilizes the crystal packing of the ABC transporter MsbA., Acta Crystallograph Sect F Struct Biol Cryst Commun 61(Pt 7):655-8

 [13] Schmitt L., 2002, The first view of an ABC transporter: the X-ray crystal structure of MsbA from E. coli., Chembiochem 3(2-3):161-5

 [14] Schultz KM., Merten JA., Klug CS., 2011, Characterization of the E506Q and H537A Dysfunctional Mutants in the E. coli ABC Transporter MsbA., Biochemistry 50(18):3599-608

 [15] Shilling RA., Balakrishnan L., Shahi S., Venter H., van Veen HW., 2003, A new dimer interface for an ABC transporter., Int J Antimicrob Agents 22(3):200-4

 [16] Siarheyeva A., Sharom FJ., 2009, The ABC transporter MsbA interacts with lipid A and amphipathic drugs at different sites., Biochem J 419(2):317-28

 [17] Thomas PJ., Hunt JF., 2001, A snapshot of Nature's favorite pump., Nat Struct Biol 8(11):920-3

 [18] Wang X., Karbarz MJ., McGrath SC., Cotter RJ., Raetz CR., 2004, MsbA transporter-dependent lipid A 1-dephosphorylation on the periplasmic surface of the inner membrane: topography of francisella novicida LpxE expressed in Escherichia coli., J Biol Chem 279(47):49470-8

 [19] Ward A., Reyes CL., Yu J., Roth CB., Chang G., 2007, Flexibility in the ABC transporter MsbA: Alternating access with a twist., Proc Natl Acad Sci U S A 104(48):19005-10

 [20] Woebking B., Velamakanni S., Federici L., Seeger MA., Murakami S., van Veen HW., 2008, Functional role of transmembrane helix 6 in drug binding and transport by the ABC transporter MsbA., Biochemistry 47(41):10904-14

 [21] Zgurskaya HI., 2002, Molecular analysis of efflux pump-based antibiotic resistance., Int J Med Microbiol 292(2):95-105

 [22] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB