RegulonDB RegulonDB 10.8: Gene Form
   

mtlA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mtlA mtlD yibI Fis Cra CRP CRP CRP CRP CRP anti-anti-terminator anti-terminator terminator TSS_4181 TSS_4181 TSS_4180 TSS_4180 TSS_4179 TSS_4179 TSS_4178 TSS_4178 mtlAp mtlAp

Gene      
Name: mtlA    Texpresso search in the literature
Synonym(s): ECK3588, EG10615, b3599, mtlC
Genome position(nucleotides): 3772281 --> 3774194 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.87
External database links:  
ASAP:
ABE-0011761
CGSC:
481
ECHOBASE:
EB0610
OU-MICROARRAY:
b3599
PortEco:
mtlA
STRING:
511145.b3599
COLOMBOS: mtlA


Product      
Name: mannitol-specific PTS enzyme IICBA component
Synonym(s): MtlA, MtlC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 67.972
Isoelectric point: 6.453
Motif(s):
 
Type Positions Sequence
165 -> 185 VNFMVVHDMLPLASIFVEPAK
379 -> 453 KIIVACDAGMGSSAMGAGVLRKKIQDAGLSQISVTNSAINNLPPDVDLVITHRDLTERAMRQVPQAQHISLTNFL
494 -> 636 FKLGAENIFLGRKAATKEEAIRFAGEQLVKGGYVEPEYVQAMLDREKLTPTYLGESIAVPHGTVEAKDRVLKTGVVFCQYPEGVRFGEEEDDIARLVIGIAARNNEHIQVITSLTNALDDESVIERLAHTTSVDEVLELLAGR
273 -> 292 VILGGMTGVFTLTILGGGLV
313 -> 334 FANIAGVCAAMAVSFVVSAILL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
GO:0022872 - protein-N(PI)-phosphohistidine-mannitol phosphotransferase system transmembrane transporter activity
GO:0090563 - protein-phosphocysteine-sugar phosphotransferase activity
GO:0090565 - protein-phosphocysteine-mannitol phosphotransferase system transporter activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0034219 - carbohydrate transmembrane transport
GO:0015797 - mannitol transport
GO:0015795 - sorbitol transport
External database links:  
DIP:
DIP-10267N
ECOCYC:
MTLA-MONOMER
ECOLIWIKI:
b3599
INTERPRO:
IPR004718
INTERPRO:
IPR036095
INTERPRO:
IPR029503
INTERPRO:
IPR016152
INTERPRO:
IPR013014
INTERPRO:
IPR013011
INTERPRO:
IPR003501
INTERPRO:
IPR003352
INTERPRO:
IPR002178
MINT:
P00550
MODBASE:
P00550
PDB:
2FEW
PDB:
1VRV
PDB:
1A3A
PDB:
1J6T
PDB:
1VKR
PFAM:
PF02378
PFAM:
PF00359
PFAM:
PF02302
PRIDE:
P00550
PRODB:
PRO_000023303
PROSITE:
PS51094
PROSITE:
PS00372
PROSITE:
PS51104
PROSITE:
PS51099
REFSEQ:
NP_418056
SMR:
P00550
UNIPROT:
P00550


Operon      
Name: mtlADR         
Operon arrangement:
Transcription unit        Promoter
mtlADR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: Cra, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4178 3772189 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4179 3774405 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4180 3774416 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4181 3774432 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB