RegulonDB RegulonDB 10.9: Gene Form
   

murC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

murC murG ddlB ftsQ ftsW ftsA RcsB SdiA SdiA SdiA ppGpp TSS_183 TSS_183 TSS_182 TSS_182 TSS_181 TSS_181 ftsAp1 ftsAp1 TSS_180 TSS_180 TSS_179 (cluster) TSS_179 (cluster) TSS_178 TSS_178 TSS_177 TSS_177 TSS_176 TSS_176 ftsQp1 ftsQp1 TSS_175 TSS_175 ftsQp2 ftsQp2 TSS_174 TSS_174 TSS_173 (cluster) TSS_173 (cluster) TSS_172 TSS_172

Gene      
Name: murC    Texpresso search in the literature
Synonym(s): ECK0092, EG10619, b0091
Genome position(nucleotides): 100765 --> 102240 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.74
External database links:  
ASAP:
ABE-0000324
CGSC:
476
ECHOBASE:
EB0614
ECOLIHUB:
murC
OU-MICROARRAY:
b0091
STRING:
511145.b0091
COLOMBOS: murC


Product      
Name: UDP-N-acetylmuramate—L-alanine ligase
Synonym(s): MurC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 53.626
Isoelectric point: 5.69
Motif(s):
 
Type Positions Sequence
124 -> 304 IAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHARLGHGRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYQGDFENLKQTFINFLHNLPFYGRAVMCVDDPVIRELLPRVGRQTTTYGFSEDADVRVEDYQQIGPQGHFTLLRQDKEPMRVTLNAPGRHNALNAAAAVAVA
344 -> 344 G
21 -> 118 HIHFVGIGGAGMGGIAEVLANEGYQISGSDLAPNPVTQQLMNLGATIYFNHRPENVRDASVVVVSSAISADNPEIVAAHEARIPVIRRAEMLAELMRF
126 -> 132 GTHGKTT
327 -> 418 RFDFLGEFPLEPVNGKSGTAMLVDDYGHHPTEVDATIKAARAGWPDKNLVMLFQPHRFTRTRDLYDDFANVLTQVDTLLMLEVYPAGEAPIP

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  6 - cell structure --> 6.2 - murein
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0005515 - protein binding
GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008763 - UDP-N-acetylmuramate-L-alanine ligase activity
GO:0000287 - magnesium ion binding
GO:0042803 - protein homodimerization activity
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0009058 - biosynthetic process
GO:0009252 - peptidoglycan biosynthetic process
GO:0008360 - regulation of cell shape
GO:0071555 - cell wall organization
External database links:  
DIP:
DIP-10278N
ECOCYC:
UDP-NACMUR-ALA-LIG-MONOMER
ECOLIWIKI:
b0091
INTERPRO:
IPR000713
INTERPRO:
IPR036565
INTERPRO:
IPR036615
INTERPRO:
IPR004101
INTERPRO:
IPR005758
INTERPRO:
IPR013221
MODBASE:
P17952
PDB:
2F00
PDB:
1CC9
PFAM:
PF01225
PFAM:
PF02875
PFAM:
PF08245
PRIDE:
P17952
PRODB:
PRO_000023314
REFSEQ:
NP_414633
SMR:
P17952
UNIPROT:
P17952


Operon      
Name: mraZ-rsmH-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC         
Operon arrangement:
Transcription unit        Promoter
mraZW-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
mraW-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsQ
ftsQAZ
ftsQAZ
ftsAZ
ftsZ
ftsZ
ftsZ
lpxC
lpxC


Transcriptional Regulation      
Display Regulation             
Repressed by: MraZ, LexA, PdhR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_172 100621 forward nd [RS-EPT-CBR] [1]
  promoter TSS_173 (cluster) 102049 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_174 102679 forward nd [RS-EPT-CBR] [1]
  promoter TSS_175 102865 forward nd [RS-EPT-CBR] [1]
  promoter TSS_176 102872 forward nd [RS-EPT-CBR] [1]
  promoter TSS_177 103019 forward nd [RS-EPT-CBR] [1]
  promoter TSS_178 103024 forward nd [RS-EPT-CBR] [1]
  promoter TSS_179 (cluster) 103028 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_180 103133 forward nd [RS-EPT-CBR] [1]
  promoter TSS_181 103608 forward nd [RS-EPT-CBR] [1]
  promoter TSS_182 103889 forward nd [RS-EPT-CBR] [1]
  promoter TSS_183 103960 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB