RegulonDB RegulonDB 10.9: Gene Form
   

mutT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

secA mutT yacG b0100 terminator anti-terminator anti-anti-terminator TSS_221 TSS_221 TSS_220 (cluster) TSS_220 (cluster) TSS_219 TSS_219 TSS_218 TSS_218 TSS_217 TSS_217 TSS_216 (cluster) TSS_216 (cluster) TSS_215 (cluster) TSS_215 (cluster) TSS_214 TSS_214 TSS_213 TSS_213 TSS_212 TSS_212 TSS_211 TSS_211 TSS_210 TSS_210 TSS_209 (cluster) TSS_209 (cluster) TSS_208 TSS_208 TSS_207 TSS_207 TSS_206 TSS_206 TSS_205 TSS_205 TSS_204 TSS_204 TSS_203 TSS_203 TSS_202 TSS_202 TSS_201 TSS_201 TSS_200 TSS_200 TSS_199 TSS_199

Gene      
Name: mutT    Texpresso search in the literature
Synonym(s): ECK0100, EG10626, b0099, nudA
Genome position(nucleotides): 111044 --> 111433 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.23
External database links:  
ASAP:
ABE-0000346
CGSC:
468
ECHOBASE:
EB0621
ECOLIHUB:
mutT
OU-MICROARRAY:
b0099
STRING:
511145.b0099
COLOMBOS: mutT


Product      
Name: 8-oxo-dGTP diphosphatase
Synonym(s): MutT, NudA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 14.927
Isoelectric point: 4.724
Motif(s):
 
Type Positions Sequence
1 -> 129 MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL
34 -> 38 EFPGG
38 -> 59 GKIEMGETPEQAVVRELQEEVG
6 -> 8 IAV
5 -> 125 QIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.15 - 2'-deoxyribonucleotide metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0000287 - magnesium ion binding
GO:0008413 - 8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity
GO:0030145 - manganese ion binding
GO:0035539 - 8-oxo-7,8-dihydrodeoxyguanosine triphosphate pyrophosphatase activity
GO:0044715 - 8-oxo-dGDP phosphatase activity
GO:0044716 - 8-oxo-GDP phosphatase activity
biological_process GO:0006260 - DNA replication
GO:0006281 - DNA repair
GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
Reference(s): [1] Krasovec R., et al., 2018
[2] Tassotto ML., et al., 2002
External database links:  
DIP:
DIP-10288N
ECOCYC:
EG10626-MONOMER
ECOLIWIKI:
b0099
INTERPRO:
IPR000086
INTERPRO:
IPR020476
INTERPRO:
IPR020084
INTERPRO:
IPR015797
INTERPRO:
IPR003561
MODBASE:
P08337
PDB:
3A6V
PDB:
3A6U
PDB:
3A6T
PDB:
3A6S
PDB:
1TUM
PDB:
1PUS
PDB:
1PUQ
PDB:
1PUN
PDB:
1PPX
PDB:
1MUT
PFAM:
PF00293
PRIDE:
P08337
PRINTS:
PR00502
PRINTS:
PR01401
PRODB:
PRO_000023327
PROSITE:
PS00893
PROSITE:
PS51462
REFSEQ:
NP_414641
SMR:
P08337
UNIPROT:
P08337


Operon      
Name: secMA-mutT         
Operon arrangement:
Transcription unit        Promoter
secMA-mutT


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_199 108703 forward nd [RS-EPT-CBR] [3]
  promoter TSS_200 108722 forward nd [RS-EPT-CBR] [3]
  promoter TSS_201 108821 forward nd [RS-EPT-CBR] [3]
  promoter TSS_202 109037 forward nd [RS-EPT-CBR] [3]
  promoter TSS_203 109101 forward nd [RS-EPT-CBR] [3]
  promoter TSS_204 109106 forward nd [RS-EPT-CBR] [3]
  promoter TSS_205 109414 forward nd [RS-EPT-CBR] [3]
  promoter TSS_206 109478 forward nd [RS-EPT-CBR] [3]
  promoter TSS_207 110273 forward nd [RS-EPT-CBR] [3]
  promoter TSS_208 110296 forward nd [RS-EPT-CBR] [3]
  promoter TSS_209 (cluster) 110304 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_210 110313 forward nd [RS-EPT-CBR] [3]
  promoter TSS_211 110324 forward nd [RS-EPT-CBR] [3]
  promoter TSS_212 110327 forward nd [RS-EPT-CBR] [3]
  promoter TSS_213 110338 forward nd [RS-EPT-CBR] [3]
  promoter TSS_214 110340 forward nd [RS-EPT-CBR] [3]
  promoter TSS_215 (cluster) 110667 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_216 (cluster) 110671 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_217 110684 forward nd [RS-EPT-CBR] [3]
  promoter TSS_218 110686 forward nd [RS-EPT-CBR] [3]
  promoter TSS_219 110690 forward nd [RS-EPT-CBR] [3]
  promoter TSS_220 (cluster) 110694 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_221 110709 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Krasovec R., Richards H., Gifford DR., Belavkin RV., Channon A., Aston E., McBain AJ., Knight CG., 2018, Opposing effects of final population density and stress on Escherichia coli mutation rate., ISME J 12(12):2981-2987

 [2] Tassotto ML., Mathews CK., 2002, Assessing the metabolic function of the MutT 8-oxodeoxyguanosine triphosphatase in Escherichia coli by nucleotide pool analysis., J Biol Chem 277(18):15807-12

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB