RegulonDB RegulonDB 10.9: Gene Form
   

narI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

narH narJ narI ychS narG Cis-reg Cis-reg terminator

Gene      
Name: narI    Texpresso search in the literature
Synonym(s): ECK1221, EG10640, b1227, chlI
Genome position(nucleotides): 1285849 --> 1286526 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.9
External database links:  
ASAP:
ABE-0004125
CGSC:
458
ECHOBASE:
EB0634
ECOLIHUB:
narI
OU-MICROARRAY:
b1227
STRING:
511145.b1227
COLOMBOS: narI


Product      
Name: nitrate reductase A subunit γ
Synonym(s): ChlI, NarI
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 25.497
Isoelectric point: 10.101
Motif(s):
 
Type Positions Sequence
73 -> 88 PHWMYEAWLPIEVKQK
52 -> 72 SNLFHIGILGIFVGHFFGMLT
83 -> 112 IEVKQKMAMFAGGASGVLCLIGGVLLLKRR
108 -> 124 LLKRRLFSPRVRATTTG
4 -> 29 LNMFFFDIYPYIAGAVFLIGSWLRYD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.2 - electron acceptors
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.1 - cytochromes
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0009325 - nitrate reductase complex
GO:0044799 - NarGHI complex
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0008940 - nitrate reductase activity
GO:0020037 - heme binding
biological_process GO:0009061 - anaerobic respiration
GO:0019645 - anaerobic electron transport chain
GO:0042128 - nitrate assimilation
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] MacGregor CH. 1975
[2] Magalon A., et al., 1998
[3] Zhao Z., et al., 2003
External database links:  
DIP:
DIP-10313N
ECOCYC:
NARI-MONOMER
ECOLIWIKI:
b1227
INTERPRO:
IPR036197
INTERPRO:
IPR023234
INTERPRO:
IPR003816
MODBASE:
P11350
PDB:
3IR6
PDB:
3IR7
PDB:
3IR5
PDB:
3EGW
PDB:
1Y5N
PDB:
1Y5L
PDB:
1Y5I
PDB:
1Y4Z
PDB:
1SIW
PDB:
1Q16
PFAM:
PF02665
PRIDE:
P11350
PRODB:
PRO_000023353
REFSEQ:
NP_415745
SMR:
P11350
UNIPROT:
P11350


Operon      
Name: narGHJI         
Operon arrangement:
Transcription unit        Promoter
narGHJI


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, IHF, RstA, NarL
Repressed by: Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] MacGregor CH., 1975, Anaerobic cytochrome b1 in Escherichia coli: association with and regulation of nitrate reductase., J Bacteriol 121(3):1111-6

 [2] Magalon A., Rothery RA., Lemesle-Meunier D., Frixon C., Weiner JH., Blasco F., 1998, Inhibitor binding within the NarI subunit (cytochrome bnr) of Escherichia coli nitrate reductase A., J Biol Chem 273(18):10851-6

 [3] Zhao Z., Rothery RA., Weiner JH., 2003, Transient kinetic studies of heme reduction in Escherichia coli nitrate reductase A (NarGHI) by menaquinol., Biochemistry 42(18):5403-13


RegulonDB