RegulonDB RegulonDB 10.9: Gene Form
   

nmpC gene in Escherichia coli K-12 genome

Gene      
Name: nmpC    Texpresso search in the literature
Synonym(s): ECK0544, EG10659, b0553, phmA
Type: Pseudo Gene
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.17
Reference(s): [1] Blasband AJ., et al., 1986
[2] Coll JL., et al., 1994
External database links:  
ASAP:
ABE-0001888
CGSC:
447
ECHOBASE:
EB0653
ECOLIHUB:
nmpC
ECOLIWIKI:
b0553
OU-MICROARRAY:
b0553
UNIPROT:
P21420
COLOMBOS: nmpC


Product      
Name: DLP12 prophage; putative outer membrane porin NmpC
Sequence: Get amino acid sequence Fasta Format
Isoelectric point: 4.431
Motif(s):
 
Type Positions Sequence
24 -> 365 AEIYNKDSNKLDLYGKVNAKHYFSSNDADDGDTTYARLGFKGETQINDQLTGFGQWEYEFKGNRAESQGSSKDKTRLAFAGLKFGDYGSIDYGRNYGVAYDIGAWTDVLPEFGGDTWTQTDVFMTQRATGVATYRNNDFFGLVDGLNFAAQYQGKNDRSDFDNYTEGNGDGFGFSATYEYEGFGIGATYAKSDRTDTQVNAGKVLPEVFASGKNAEVWAAGLKYDANNIYLATTYSETQNMTVFADHFVANKAQNFEAVAQYQFDFGLRPSVAYLQSKGKDLGVWGDQDLVKYVDVGATYYFNKNMSTFVDYKINLLDKNDFTKALGVSTDDIVAVGLVYQF
1 -> 23 MKKLTVAISAVAASVLMAMSAQA
326 -> 326 N

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0046930 - pore complex
molecular_function GO:0015288 - porin activity
biological_process GO:0006811 - ion transport
GO:0034220 - ion transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG10659-MONOMER
ECOLIWIKI:
b0553
INTERPRO:
IPR033900
INTERPRO:
IPR023614
INTERPRO:
IPR013793
INTERPRO:
IPR001702
INTERPRO:
IPR001897
MINT:
P21420
MODBASE:
P21420
PFAM:
PF00267
PRIDE:
P21420
PRINTS:
PR00182
PRINTS:
PR00183
PROSITE:
PS00576
REFSEQ:
NP_415085
SMR:
P21420
SWISSMODEL:
P21420
UNIPROT:
P21420


Operon      
Name: nmpC         
Operon arrangement:
Transcription unit        Promoter
nmpC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: MprA, OmpR, IHF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Blasband AJ., Marcotte WR., Schnaitman CA., 1986, Structure of the lc and nmpC outer membrane porin protein genes of lambdoid bacteriophage., J Biol Chem 261(27):12723-32

 [2] Coll JL., Heyde M., Portalier R., 1994, Expression of the nmpC gene of Escherichia coli K-12 is modulated by external pH. Identification of cis-acting regulatory sequences involved in this regulation., Mol Microbiol 12(1):83-93


RegulonDB