RegulonDB RegulonDB 10.10: Gene Form
   

nupG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

speC nupG mltC CRP CRP CRP CytR CytR CytR CRP terminator anti-terminator anti-anti-terminator nupGp nupGp

Gene      
Name: nupG    Texpresso search in the literature
Synonym(s): ECK2959, EG10664, b2964, gru
Genome position(nucleotides): 3105714 --> 3106970 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.72
External database links:  
ASAP:
ABE-0009728
CGSC:
442
ECHOBASE:
EB0658
ECOLIHUB:
nupG
OU-MICROARRAY:
b2964
STRING:
511145.b2964
COLOMBOS: nupG


Product      
Name: nucleoside:H+ symporter NupG
Synonym(s): Gru, NupG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 46.389
Isoelectric point: 8.799
Motif(s):
 
Type Positions Sequence
1 -> 406 MNLKLQLKILSFLQFCLWGSWLTTLGSYMFVTLKFDGASIGAVYSSLGIAAVFMPALLGIVADKWLSAKWVYAICHTIGAITLFMAAQVTTPEAMFLVILINSFAYMPTLGLINTISYYRLQNAGMDIVTDFPPIRIWGTIGFIMAMWVVSLSGFELSHMQLYIGAALSAILVLFTLTLPHIPVAKQQANQSWTTLLGLDAFALFKNKRMAIFFIFSMLLGAELQITNMFGNTFLHSFDKDPMFASSFIVQHASIIMSISQISETLFILTIPFFLSRYGIKNVMMISIVAWILRFALFAYGDPTPFGTVLLVLSMIVYGCAFDFFNISGSVFVEKEVSPAIRASAQGMFLMMTNGFGCILGGIVSGKVVEMYTQNGITDWQTVWLIFAGYSVVLAFAFMAMFKYKH
40 -> 60 IGAVYSSLGIAAVFMPALLGI
136 -> 136 R
210 -> 230 MAIFFIFSMLLGAELQITNMF
318 -> 318 Y

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015506 - nucleoside:proton symporter activity
biological_process GO:1901642 - nucleoside transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Doskocil J. 1974
[2] Jindal S., et al., 2019
[3] Komatsu Y. 1971
[4] Komatsu Y., et al., 1972
[5] Leung KK., et al., 1977
[6] Munch-Petersen A., et al., 1990
[7] Munch-Petersen A., et al., 1980
[8] Mygind B., et al., 1975
[9] Pao SS., et al., 1998
[10] Tong M., et al., 2020
[11] Vaziri H., et al., 2013
External database links:  
ECOCYC:
NUPG-MONOMER
ECOLIWIKI:
b2964
INTERPRO:
IPR033667
INTERPRO:
IPR036259
INTERPRO:
IPR020846
INTERPRO:
IPR004740
MODBASE:
P0AFF4
PDB:
7DL9
PFAM:
PF03825
PRIDE:
P0AFF4
PRODB:
PRO_000023443
PROSITE:
PS50850
REFSEQ:
NP_417439
UNIPROT:
P0AFF4


Operon      
Name: mutY-yggX-mltC-nupG         
Operon arrangement:
Transcription unit        Promoter
mutY-yggX
mutY-yggX-mltC
mutY-yggX-mltC-nupG
mutY-yggX
mutY-yggX-mltC
mutY-yggX-mltC-nupG
yggX
yggX-mltC
yggX-mltC-nupG
nupG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: CRP, DeoR, CytR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Doskocil J., 1974, Inducible nucleoside permease in Escherichia coli., Biochem Biophys Res Commun 56(4):997-1003

 [2] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [3] Komatsu Y., 1971, Mechanism of action of showdomycin. V. Reduced ability of showdomycin-resistant mutants of Escherichia coli K-12 to take up showdomycin and nucleosides., J Antibiot (Tokyo) 24(12):876-83

 [4] Komatsu Y., Tanaka K., 1972, A showdomycin-resistant mutant of Escherichia coli K-12 with altered nucleoside transport character., Biochim Biophys Acta 288(2):390-403

 [5] Leung KK., Visser DW., 1977, Uridine and cytidine transport in Escherichia coli B and transport-deficient mutants., J Biol Chem 252(8):2492-7

 [6] Munch-Petersen A., Jensen N., 1990, Analysis of the regulatory region of the Escherichia coli nupG gene, encoding a nucleoside-transport protein., Eur J Biochem 190(3):547-51

 [7] Munch-Petersen A., Pihl NJ., 1980, Stimulatory effect of low ATP pools on transport of purine nucleosides in cells of Escherichia coli., Proc Natl Acad Sci U S A 77(5):2519-23

 [8] Mygind B., Munch-Petersen., 1975, Transport of pyrimidine nucleosides in cells of Escherichia coli K 12., Eur J Biochem 59(2):365-72

 [9] Pao SS., Paulsen IT., Saier MH., 1998, Major facilitator superfamily., Microbiol Mol Biol Rev 62(1):1-34

 [10] Tong M., French S., El Zahed SS., Ong WK., Karp PD., Brown ED., 2020, Gene Dispensability in Escherichia coli Grown in Thirty Different Carbon Environments., mBio 11(5)

 [11] Vaziri H., Baldwin SA., Baldwin JM., Adams DG., Young JD., Postis VL., 2013, Use of molecular modelling to probe the mechanism of the nucleoside transporter NupG., Mol Membr Biol 30(2):114-28


RegulonDB