RegulonDB RegulonDB 10.9: Gene Form
   

ogt gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

abgT fnr ogt NarL Fis NarL NarL NarL IHF FNR ogtp ogtp fnrp fnrp

Gene      
Name: ogt    Texpresso search in the literature
Synonym(s): ECK1331, EG10668, b1335
Genome position(nucleotides): 1399721 <-- 1400236 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.1
External database links:  
ASAP:
ABE-0004486
CGSC:
31984
ECHOBASE:
EB0662
ECOLIHUB:
ogt
OU-MICROARRAY:
b1335
STRING:
511145.b1335
COLOMBOS: ogt


Product      
Name: methylated-DNA—[protein]-cysteine S-methyltransferase
Synonym(s): MTase II, O-6-alkylguanine-DNA/Cysteine-protein-methyltransferase, O6AG ATase, O6-alkylguanine-DNA-alkyltransferase, Ogt
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.179
Isoelectric point: 8.463
Motif(s):
 
Type Positions Sequence
102 -> 102 C
139 -> 139 C
4 -> 83 LLEEKIATPLGPLWVICDEQFRLRAVEWEEYSERMVQLLDIHYRKEGYERISATNPGGLSDKLREYFAGNLSIIDTLPTA
68 -> 68 E
88 -> 167 PFQREVWKTLRTIPCGQVMHYGQLAEQLGRPGAARAVGAANGSNPISIVVPCHRVIGRNGTMTGYAGGVQRKEWLLRHEG

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.2 - DNA restriction/modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.1 - DNA structure level --> 3.1.1.2 - methylation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0003908 - methylated-DNA-[protein]-cysteine S-methyltransferase activity
biological_process GO:0006281 - DNA repair
GO:0006974 - cellular response to DNA damage stimulus
GO:0032259 - methylation
GO:0006307 - DNA dealkylation involved in DNA repair
Note(s): Note(s): ...[more].
Reference(s): [1] Abril N., et al., 1992
[2] Ferrezuelo F., et al., 1998
[3] Ferrezuelo F., et al., 1998
[4] Harris LC., et al., 1993
[5] Ihara K., et al., 1994
[6] Jurado J., et al., 1995
[7] Mackay WJ., et al., 1994
[8] Margison GP., et al., 1985
[9] Potter PM., et al., 1989
[10] Potter PM., et al., 1989
[11] Potter PM., et al., 1987
[12] Rebeck GW., et al., 1988
[13] Rebeck GW., et al., 1991
[14] Rye PT., et al., 2008
[15] Sassanfar M., et al., 1991
[16] Taira K., et al., 2013
[17] Takano K., et al., 1991
[18] Vidal A., et al., 1995
[19] Vidal A., et al., 1997
[20] Vidal A., et al., 1998
[21] Wilkinson MC., et al., 1989
External database links:  
DIP:
DIP-48073N
ECOCYC:
EG10668-MONOMER
ECOLIWIKI:
b1335
INTERPRO:
IPR023546
INTERPRO:
IPR036217
INTERPRO:
IPR036388
INTERPRO:
IPR014048
INTERPRO:
IPR036631
INTERPRO:
IPR001497
INTERPRO:
IPR008332
MODBASE:
P0AFH0
PFAM:
PF01035
PFAM:
PF02870
PRIDE:
P0AFH0
PROSITE:
PS00374
REFSEQ:
NP_415851
SMR:
P0AFH0
SWISSMODEL:
P0AFH0
UNIPROT:
P0AFH0


Operon      
Name: abgABT-ogt         
Operon arrangement:
Transcription unit        Promoter
ogt
abgABT-ogt


Transcriptional Regulation      
Display Regulation             
Activated by: NarL
Repressed by: Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Abril N., Roldan-Arjona T., Prieto-Alamo MJ., van Zeeland AA., Pueyo C., 1992, Mutagenesis and DNA repair for alkylation damages in Escherichia coli K-12., Environ Mol Mutagen 19(4):288-96

 [2] Ferrezuelo F., Prieto-Alamo MJ., Jurado J., Pueyo C., 1998, Influence of DNA repair by (A)BC excinuclease and Ogt alkyltransferase on the distribution of mutations induced by n-propyl-N-nitrosourea in Escherichia coli., Environ Mol Mutagen 31(1):82-91

 [3] Ferrezuelo F., Prieto-Alamo MJ., Jurado J., Pueyo C., 1998, Role of DNA repair by (A)BC excinuclease and Ogt alkyltransferase in the final distribution of LacI-d mutations induced by N-butyl-N-nitrosourea in Escherichia coli., Mutagenesis 13(5):507-14

 [4] Harris LC., Margison GP., 1993, Expression in mammalian cells of the Escherichia coli O6 alkylguanine-DNA-alkyltransferase gene ogt reduces the toxicity of alkylnitrosoureas., Br J Cancer 67(6):1196-202

 [5] Ihara K., Kawate H., Chueh LL., Hayakawa H., Sekiguchi M., 1994, Requirement of the Pro-Cys-His-Arg sequence for O6-methylguanine-DNA methyltransferase activity revealed by saturation mutagenesis with negative and positive screening., Mol Gen Genet 243(4):379-89

 [6] Jurado J., Ferrezuelo F., Pueyo C., 1995, Mutational specificity of 1-(2-chloroethyl)-3-cyclohexyl-1-nitrosourea in the Escherichia coli lacl gene of O6-alkylguanine-DNA alkyltransferase-proficient and -deficient strains., Mol Carcinog 14(4):233-9

 [7] Mackay WJ., Han S., Samson LD., 1994, DNA alkylation repair limits spontaneous base substitution mutations in Escherichia coli., J Bacteriol 176(11):3224-30

 [8] Margison GP., Cooper DP., Brennand J., 1985, Cloning of the E. coli O6-methylguanine and methylphosphotriester methyltransferase gene using a functional DNA repair assay., Nucleic Acids Res 13(6):1939-52

 [9] Potter PM., Harris L., Margison GP., 1989, Mapping of OGT in the E.coli chromosome., Nucleic Acids Res 17(24):10505

 [10] Potter PM., Kleibl K., Cawkwell L., Margison GP., 1989, Expression of the ogt gene in wild-type and ada mutants of E. coli., Nucleic Acids Res 17(20):8047-60

 [11] Potter PM., Wilkinson MC., Fitton J., Carr FJ., Brennand J., Cooper DP., Margison GP., 1987, Characterisation and nucleotide sequence of ogt, the O6-alkylguanine-DNA-alkyltransferase gene of E. coli., Nucleic Acids Res 15(22):9177-93

 [12] Rebeck GW., Coons S., Carroll P., Samson L., 1988, A second DNA methyltransferase repair enzyme in Escherichia coli., Proc Natl Acad Sci U S A 85(9):3039-43

 [13] Rebeck GW., Samson L., 1991, Increased spontaneous mutation and alkylation sensitivity of Escherichia coli strains lacking the ogt O6-methylguanine DNA repair methyltransferase., J Bacteriol 173(6):2068-76

 [14] Rye PT., Delaney JC., Netirojjanakul C., Sun DX., Liu JZ., Essigmann JM., 2008, Mismatch repair proteins collaborate with methyltransferases in the repair of O(6)-methylguanine., DNA Repair (Amst) 7(2):170-6

 [15] Sassanfar M., Dosanjh MK., Essigmann JM., Samson L., 1991, Relative efficiencies of the bacterial, yeast, and human DNA methyltransferases for the repair of O6-methylguanine and O4-methylthymine. Suggestive evidence for O4-methylthymine repair by eukaryotic methyltransferases., J Biol Chem 266(5):2767-71

 [16] Taira K., Kaneto S., Nakano K., Watanabe S., Takahashi E., Arimoto S., Okamoto K., Schaaper RM., Negishi K., Negishi T., 2013, Distinct pathways for repairing mutagenic lesions induced by methylating and ethylating agents., Mutagenesis 28(3):341-50

 [17] Takano K., Nakamura T., Sekiguchi M., 1991, Roles of two types of O6-methylguanine-DNA methyltransferases in DNA repair., Mutat Res 254(1):37-44

 [18] Vidal A., Abril N., Pueyo C., 1995, DNA repair by Ogt alkyltransferase influences EMS mutational specificity., Carcinogenesis 16(4):817-21

 [19] Vidal A., Abril N., Pueyo C., 1997, The influence of DNA repair by Ogt alkyltransferase on the distribution of alkylnitrosourea-induced mutations in Escherichia coli., Environ Mol Mutagen 29(2):180-8

 [20] Vidal A., Abril N., Pueyo C., 1998, DNA sequence analysis of spontaneous lacI-d mutations in O6-alkylguanine-DNA alkyltransferase-proficient and -deficient Escherichia coli., Mutagenesis 13(4):367-73

 [21] Wilkinson MC., Potter PM., Cawkwell L., Georgiadis P., Patel D., Swann PF., Margison GP., 1989, Purification of the E. coli ogt gene product to homogeneity and its rate of action on O6-methylguanine, O6-ethylguanine and O4-methylthymine in dodecadeoxyribonucleotides., Nucleic Acids Res 17(21):8475-84


RegulonDB