RegulonDB RegulonDB 11.0: Gene Form
   

pabB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pabB nudL yoaH TSS_2138 TSS_2138 TSS_2137 TSS_2137 yoaHp1 yoaHp1 pabBp6 pabBp6 TSS_2136 TSS_2136 pabBp7 pabBp7

Gene      
Name: pabB    Texpresso search in the literature
Synonym(s): ECK1810, EG10683, b1812
Genome position(nucleotides): 1894805 --> 1896166
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.95
External database links:  
ASAP:
ABE-0006031
CGSC:
428
ECHOBASE:
EB0677
ECOLIHUB:
pabB
OU-MICROARRAY:
b1812
STRING:
511145.b1812
COLOMBOS: pabB


Product      
Name: aminodeoxychorismate synthase subunit 1
Synonym(s): ADC synthase, PabB, aminodeoxychorismate synthase component 1
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 50.97
Isoelectric point: 4.876
Motif(s):
 
Type Positions Sequence Comment
22 -> 153 FSRLSHLPWAMLLHSGYADHPYSRFDIVVAEPICTLTTFGKETVVSESEKRTTTTDDPLQVLQQVLDRADIRPTHNEDLPFQGGALGLFGYDLGRRFESLPEIAEQDIVLPDMAVGIYDWALIVDHQRHTVS
43 -> 46 YSRF UniProt: Tryptophan binding; Sequence Annotation Type: region of interest.
190 -> 443 REQYGEKFRQVQEYLHSGDCYQVNLAQRFHATYSGDEWQAFLQLNQANRAPFSAFLRLEQGAILSLSPERFILCDNSEIQTRPIKGTLPRLPDPQEDSKQAVKLANSAKDRAENLMIVDLMRNDIGRVAVAGSVKVPELFVVEPFPAVHHLVSTITAQLPEQLHASDLLRAAFPGGSITGAPKVRAMEIIDELEPQRRNAWCGSIGYLSFCGNMDTSITIRTLTAINGQIFCSAGGGIVADSQEEAEYQETFDK
240 -> 242 PFS UniProt: Tryptophan binding; Sequence Annotation Type: region of interest.
258 -> 258 E UniProt: The reaction is extremely slow..

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.2 - folic acid
Gene Ontology Terms (GO)  
cellular_component GO:0009356 - aminodeoxychorismate synthase complex
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0120284 - tryptophan binding
GO:0016740 - transferase activity
GO:0046820 - 4-amino-4-deoxychorismate synthase activity
GO:0000287 - magnesium ion binding
GO:0046982 - protein heterodimerization activity
biological_process GO:0008153 - para-aminobenzoic acid biosynthetic process
GO:0009058 - biosynthetic process
GO:0009396 - folic acid-containing compound biosynthetic process
GO:0046656 - folic acid biosynthetic process
GO:0046654 - tetrahydrofolate biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Chung DH., et al., 2017
[2] Guttman DS., et al., 1994
[3] McLeish MJ., et al., 1988
[4] Tewari YB., et al., 2002
External database links:  
ALPHAFOLD:
P05041
DIP:
DIP-10434N
ECOCYC:
PABASYN-COMPI-MONOMER
ECOLIWIKI:
b1812
INTERPRO:
IPR005801
INTERPRO:
IPR019999
INTERPRO:
IPR006805
INTERPRO:
IPR005802
INTERPRO:
IPR015890
MODBASE:
P05041
PDB:
1K0E
PDB:
1K0G
PFAM:
PF00425
PFAM:
PF04715
PRIDE:
P05041
PRINTS:
PR00095
PRODB:
PRO_000023485
REFSEQ:
NP_416326
SMR:
P05041
UNIPROT:
P05041


Operon      
Name: pabB-nudL         
Operon arrangement:
Transcription unit        Promoter
pabB-nudL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter pabBp7 1894628 forward nd [ICWHO] [5]
  promoter TSS_2136 1894757 forward nd [RS-EPT-CBR] [6]
  promoter pabBp6 1894779 forward nd [ICWHO] [5]
  promoter yoaHp1 1894933 reverse nd [ICWHO] [5]
  promoter TSS_2137 1896141 forward nd [RS-EPT-CBR] [6]
  promoter TSS_2138 1896143 forward nd [RS-EPT-CBR] [6]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Chung DH., Potter SC., Tanomrat AC., Ravikumar KM., Toney MD., 2017, Site-directed mutant libraries for isolating minimal mutations yielding functional changes., Protein Eng Des Sel 30(5):347-357

 [2] Guttman DS., Dykhuizen DE., 1994, Detecting selective sweeps in naturally occurring Escherichia coli., Genetics 138(4):993-1003

 [3] McLeish MJ., Wookey PJ., Mortimer KG., 1988, The cloning and over-expression of PABA synthase in E. coli., Biochem Int 16(4):727-35

 [4] Tewari YB., Jensen PY., Kishore N., Mayhew MP., Parsons JF., Eisenstein E., Goldberg RN., 2002, Thermodynamics of reactions catalyzed by PABA synthase., Biophys Chem 96(1):33-51

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB