RegulonDB RegulonDB 10.9: Gene Form
   

pepP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pepP ubiI ubiH ygfB TSS_3182 TSS_3182 TSS_3181 TSS_3181 TSS_3180 TSS_3180 TSS_3179 TSS_3179 TSS_3178 TSS_3178 TSS_3177 TSS_3177

Gene      
Name: pepP    Texpresso search in the literature
Synonym(s): ECK2903, EG10697, b2908
Genome position(nucleotides): 3053515 <-- 3054840 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.54
External database links:  
ASAP:
ABE-0009549
CGSC:
28682
ECHOBASE:
EB0691
ECOLIHUB:
pepP
MIM:
613159
OU-MICROARRAY:
b2908
STRING:
511145.b2908
COLOMBOS: pepP


Product      
Name: Xaa-Pro aminopeptidase
Synonym(s): PepP, proline aminopeptidase P II
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 49.815
Isoelectric point: 5.08
Motif(s):
 
Type Positions Sequence
2 -> 441 SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
9 -> 128 FQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVV
185 -> 414 LRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  2 - information transfer --> 2.3 - protein related --> 2.3.6 - turnover, degradation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0005515 - protein binding
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004177 - aminopeptidase activity
GO:0008235 - metalloexopeptidase activity
GO:0008237 - metallopeptidase activity
GO:0030145 - manganese ion binding
GO:0042802 - identical protein binding
GO:0070006 - metalloaminopeptidase activity
biological_process GO:0006508 - proteolysis
GO:0051289 - protein homotetramerization
External database links:  
DIP:
DIP-10459N
ECOCYC:
EG10697-MONOMER
ECOLIWIKI:
b2908
INTERPRO:
IPR001131
INTERPRO:
IPR036005
INTERPRO:
IPR001714
INTERPRO:
IPR007865
INTERPRO:
IPR029149
INTERPRO:
IPR000994
MODBASE:
P15034
PDB:
2BHA
PDB:
2BHB
PDB:
2BHC
PDB:
2BHD
PDB:
2BN7
PDB:
2BWS
PDB:
2BWT
PDB:
2BWU
PDB:
2BWV
PDB:
2BWW
PDB:
2BWX
PDB:
2BWY
PDB:
2V3X
PDB:
2V3Y
PDB:
2V3Z
PDB:
2BH3
PDB:
1WLR
PDB:
1WL9
PDB:
1WL6
PDB:
1WBQ
PDB:
1W7V
PDB:
1W2M
PDB:
1N51
PDB:
1M35
PDB:
1JAW
PDB:
1A16
PFAM:
PF05195
PFAM:
PF00557
PRIDE:
P15034
PRINTS:
PR00599
PRODB:
PRO_000023511
PROSITE:
PS00491
REFSEQ:
NP_417384
SMART:
SM01011
SMR:
P15034
UNIPROT:
P15034


Operon      
Name: ygfB-pepP-ubiHI         
Operon arrangement:
Transcription unit        Promoter
ygfB-pepP-ubiHI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3177 3052030 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3178 3052033 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3179 3052058 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3180 3052060 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3181 3052064 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3182 3052819 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB