RegulonDB RegulonDB 10.8: Gene Form
   

phnC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

phnD phnC yjdN phnCp phnCp

Gene      
Name: phnC    Texpresso search in the literature
Synonym(s): ECK4099, EG10713, b4106
Genome position(nucleotides): 4324377 <-- 4325165 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.56
External database links:  
ASAP:
ABE-0013444
CGSC:
34553
ECHOBASE:
EB0707
OU-MICROARRAY:
b4106
PortEco:
phnC
STRING:
511145.b4106
COLOMBOS: phnC


Product      
Name: phosphonate/phosphate ABC transporter ATP binding subunit
Synonym(s): PhnC, cryptic phosphonate ABC transporter ATP binding subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 29.431
Isoelectric point: 10.131
Motif(s):
 
Type Positions Sequence
173 -> 179 VILADEP
153 -> 156 LSGG
20 -> 181 LHAVDLNIHHGEMVALLGPSGSGKSTLLRHLSGLITGDKSVGSHIELLGRTVQREGRLARDIRKSRAHTGYIFQQFNLVNRLSVLENVLIGALGSTPFWRTCFSWFTGEQKQRALQALTRVGMVHFAHQRVSTLSGGQQQRVAIARALMQQAKVILADEPIA
87 -> 87 H
255 -> 255 V

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.3 - starvation
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015416 - ATPase-coupled organic phosphonate transmembrane transporter activity
biological_process GO:0015716 - organic phosphonate transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
PHNC-MONOMER
ECOLIWIKI:
b4106
INTERPRO:
IPR012693
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR003593
INTERPRO:
IPR003439
MODBASE:
P16677
PFAM:
PF00005
PRIDE:
P16677
PRODB:
PRO_000023532
PROSITE:
PS50893
PROSITE:
PS51249
PROSITE:
PS00211
REFSEQ:
NP_418530
SMART:
SM00382
SMR:
P16677
UNIPROT:
P16677


Operon      
Name: phnCDEFGHIJKLMNOP         
Operon arrangement:
Transcription unit        Promoter
phnCDEEFGHIJKLMNOP
phnLMNOP


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB