RegulonDB RegulonDB 10.8: Gene Form
   

phnD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

phnD phnE phnC phnF

Gene      
Name: phnD    Texpresso search in the literature
Synonym(s): ECK4098, EG10714, b4105, phn, psiD
Genome position(nucleotides): 4323336 <-- 4324352 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.46
External database links:  
ASAP:
ABE-0013442
CGSC:
17638
ECHOBASE:
EB0708
OU-MICROARRAY:
b4105
PortEco:
phnD
STRING:
511145.b4105
COLOMBOS: phnD


Product      
Name: phosphonate/phosphate ABC transporter periplasmic binding protein
Synonym(s): Phn, PhnD, PsiD, cryptic phosphonate ABC transporter periplasmic binding protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 37.371
Isoelectric point: 9.107
Motif(s):
 
Type Positions Sequence
1 -> 26 MNAKIIASLAFTSMFSLSTLLSPAHA
27 -> 338 EEQEKALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQGVKSNKGLNEQDKLAKTTEIQAQLDDLDRLNNALSAMSSVSKAVQ
312 -> 312 E
35 -> 277 FGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSD

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0042597 - periplasmic space
GO:0043190 - ATP-binding cassette (ABC) transporter complex
biological_process GO:0015716 - organic phosphonate transport
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Alicea I., et al., 2011
External database links:  
DIP:
DIP-10483N
ECOCYC:
PHND-MONOMER
ECOLIWIKI:
b4105
INTERPRO:
IPR017797
INTERPRO:
IPR005770
MODBASE:
P16682
PANTHER:
PTHR30043:SF5
PFAM:
PF12974
PRIDE:
P16682
PRODB:
PRO_000023533
REFSEQ:
NP_418529
SMR:
P16682
UNIPROT:
P16682


Operon      
Name: phnCDEFGHIJKLMNOP         
Operon arrangement:
Transcription unit        Promoter
phnCDEEFGHIJKLMNOP
phnLMNOP


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Alicea I., Marvin JS., Miklos AE., Ellington AD., Looger LL., Schreiter ER., 2011, Structure of the Escherichia coli phosphonate binding protein PhnD and rationally optimized phosphonate biosensors., J Mol Biol 414(3):356-69


RegulonDB