RegulonDB RegulonDB 10.9: Gene Form
   

phnF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

phnD phnE phnF phnG phnH

Gene      
Name: phnF    Texpresso search in the literature
Synonym(s): ECK4095, EG10715, b4102
Genome position(nucleotides): 4321697 <-- 4322422 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
61.85
External database links:  
ASAP:
ABE-0013435
CGSC:
34547
ECHOBASE:
EB0709
ECOLIHUB:
phnF
OU-MICROARRAY:
b4102
STRING:
511145.b4102
COLOMBOS: phnF


Product      
Name: putative transcriptional regulator PhnF
Synonym(s): PhnF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.621
Isoelectric point: 8.639
Motif(s):
 
Type Positions Sequence
96 -> 235 DQGSHPTSEKLLSVLRPASGHVADALGITEGENVIHLRTLRRVNGVALCLIDHYFADLTLWPTLQRFDSGSLHDFLREQTGIALRRSQTRISARRAQAKECQRLEIPNMSPLLCVRTLNHRDGESSPAEYSVSLTRADMI
14 -> 75 YQEIAAKLEQELRQHYRCGDYLPAEQQLAARFEVNRHTLRRAIDQLVEKGWVQRRQGVGVLV
38 -> 57 EQQLAARFEVNRHTLRRAID
11 -> 78 PTRYQEIAAKLEQELRQHYRCGDYLPAEQQLAARFEVNRHTLRRAIDQLVEKGWVQRRQGVGVLVLMR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0015716 - organic phosphonate transport
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
Reference(s): [1] Aravind L., et al., 2003
[2] Gorelik M., et al., 2006
[3] Rigali S., et al., 2002
External database links:  
ECOCYC:
EG10715-MONOMER
ECOLIWIKI:
b4102
INTERPRO:
IPR036388
INTERPRO:
IPR036390
INTERPRO:
IPR028978
INTERPRO:
IPR000524
INTERPRO:
IPR011663
INTERPRO:
IPR012702
MODBASE:
P16684
PDB:
2FA1
PFAM:
PF07702
PFAM:
PF00392
PRIDE:
P16684
PRINTS:
PR00035
PROSITE:
PS50949
REFSEQ:
NP_418526
SMART:
SM00866
SMART:
SM00345
SMR:
P16684
SWISSMODEL:
P16684
UNIPROT:
P16684


Operon      
Name: phnCDEFGHIJKLMNOP         
Operon arrangement:
Transcription unit        Promoter
phnCDEEFGHIJKLMNOP
phnLMNOP


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Aravind L., Anantharaman V., 2003, HutC/FarR-like bacterial transcription factors of the GntR family contain a small molecule-binding domain of the chorismate lyase fold., FEMS Microbiol Lett 222(1):17-23

 [2] Gorelik M., Lunin VV., Skarina T., Savchenko A., 2006, Structural characterization of GntR/HutC family signaling domain., Protein Sci 15(6):1506-11

 [3] Rigali S., Derouaux A., Giannotta F., Dusart J., 2002, Subdivision of the helix-turn-helix GntR family of bacterial regulators in the FadR, HutC, MocR, and YtrA subfamilies., J Biol Chem 277(15):12507-15


RegulonDB