RegulonDB RegulonDB 10.8: Gene Form
   

phnH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

phnI phnJ phnF phnH phnG phnK

Gene      
Name: phnH    Texpresso search in the literature
Synonym(s): ECK4093, EG10717, b4100
Genome position(nucleotides): 4320663 <-- 4321247 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
60.85
External database links:  
ASAP:
ABE-0013430
CGSC:
34541
ECHOBASE:
EB0711
OU-MICROARRAY:
b4100
PortEco:
phnH
STRING:
511145.b4100
COLOMBOS: phnH


Product      
Name: carbon-phosphorus lyase core complex subunit PhnH
Synonym(s): PhnH, PhnH subunit of methylphosphonate degradation complex
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.027
Isoelectric point: 5.194
Motif(s):
 
Type Positions Sequence
6 -> 192 AFMLPVQDAQHSFRRLLKAMSEPGVIVALHQLKRGWQPLNIATTSVLLTLADNDTPVWLSTPLNNDIVNQSLRFHTNAPLVSQPEQATFAVTDEAISSEQLNALSTGTAVAPEAGATLILQVASLSGGRMLRLTGAGIAEERMIAPQLPECILHELTERPHPFPLGIDLILTCGERLLAIPRTTHVE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
Gene Ontology Terms (GO)  
cellular_component GO:1904176 - carbon phosphorus lyase complex
GO:0005829 - cytosol
GO:0061694 - alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase complex
molecular_function GO:0016740 - transferase activity
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
GO:0061693 - alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase activity
biological_process GO:0019634 - organic phosphonate metabolic process
GO:0019700 - organic phosphonate catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10487N
ECOCYC:
EG10717-MONOMER
ECOLIWIKI:
b4100
INTERPRO:
IPR038058
INTERPRO:
IPR008772
PDB:
4XB6
PDB:
2FSU
PFAM:
PF05845
PRIDE:
P16686
PRODB:
PRO_000023534
REFSEQ:
NP_418524
SMR:
P16686
UNIPROT:
P16686


Operon      
Name: phnCDEFGHIJKLMNOP         
Operon arrangement:
Transcription unit        Promoter
phnCDEEFGHIJKLMNOP
phnLMNOP


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB