RegulonDB RegulonDB 10.8: Gene Form
   

phnK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

phnI phnJ phnK phnL phnM

Gene      
Name: phnK    Texpresso search in the literature
Synonym(s): ECK4090, EG10720, b4097
Genome position(nucleotides): 4318006 <-- 4318764 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
61.4
External database links:  
ASAP:
ABE-0013424
CGSC:
34532
ECHOBASE:
EB0714
OU-MICROARRAY:
b4097
PortEco:
phnK
STRING:
511145.b4097
COLOMBOS: phnK


Product      
Name: carbon-phosphorus lyase subunit PhnK
Synonym(s): PhnK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.831
Isoelectric point: 6.81
Motif(s):
 
Type Positions Sequence
47 -> 47 L
6 -> 246 LSVNNLTHLYAPGKGFSDVSFDLWPGEVLGIVGESGSGKTTLLKSISARLTPQQGEIHYENRSLYAMSEADRRRLLRTEWGVVHQHPLDGLRRQVSAGGNIGERLMATGARHYGDIRATAQKWLEEVEIPANRIDDLPTTFSGGMQQRLQIARNLVTHPKLVFMDEPTGGLDVSVQARLLDLLRGLVVELNLAVVIVTHDLGVARLLADRLLVMKQGQVVESGLTDRVLDDPHHPYTQLLV
22 -> 173 SDVSFDLWPGEVLGIVGESGSGKTTLLKSISARLTPQQGEIHYENRSLYAMSEADRRRLLRTEWGVVHQHPLDGLRRQVSAGGNIGERLMATGARHYGDIRATAQKWLEEVEIPANRIDDLPTTFSGGMQQRLQIARNLVTHPKLVFMDEPT
38 -> 45 GESGSGKT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
Gene Ontology Terms (GO)  
cellular_component GO:1904176 - carbon phosphorus lyase complex
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0019700 - organic phosphonate catabolic process
Note(s): Note(s): ...[more].
Evidence: [IEP] Inferred from expression pattern
[IGI] Inferred from genetic interaction
[IMP] Inferred from mutant phenotype
Reference(s): [1] Metcalf WW., et al., 1991
[2] Metcalf WW., et al., 1993
[3] Yakovleva GM., et al., 1998
External database links:  
DIP:
DIP-10490N
ECOCYC:
PHNK-MONOMER
ECOLIWIKI:
b4097
INTERPRO:
IPR003593
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR012700
INTERPRO:
IPR003439
MODBASE:
P16678
PFAM:
PF00005
PRIDE:
P16678
PROSITE:
PS50893
PROSITE:
PS00211
REFSEQ:
YP_026282
SMART:
SM00382
SMR:
P16678
UNIPROT:
P16678


Operon      
Name: phnCDEFGHIJKLMNOP         
Operon arrangement:
Transcription unit        Promoter
phnCDEEFGHIJKLMNOP
phnLMNOP


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Metcalf WW., Wanner BL., 1991, Involvement of the Escherichia coli phn (psiD) gene cluster in assimilation of phosphorus in the form of phosphonates, phosphite, Pi esters, and Pi., J Bacteriol 173(2):587-600

 [2] Metcalf WW., Wanner BL., 1993, Mutational analysis of an Escherichia coli fourteen-gene operon for phosphonate degradation, using TnphoA' elements., J Bacteriol 175(11):3430-42

 [3] Yakovleva GM., Kim SK., Wanner BL., 1998, Phosphate-independent expression of the carbon-phosphorus lyase activity of Escherichia coli., Appl Microbiol Biotechnol 49(5):573-8


RegulonDB