RegulonDB RegulonDB 10.8: Gene Form
   

phnM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

phnM phnK phnL phnN phnO phnJ

Gene      
Name: phnM    Texpresso search in the literature
Synonym(s): ECK4088, EG10722, b4095
Genome position(nucleotides): 4316082 <-- 4317218 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
61.3
External database links:  
ASAP:
ABE-0013419
CGSC:
34526
ECHOBASE:
EB0716
OU-MICROARRAY:
b4095
PortEco:
phnM
STRING:
511145.b4095
COLOMBOS: phnM


Product      
Name: RPnTP hydrolase
Synonym(s): PhnM
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 42.01
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
284 -> 378 VAASELAQLGLLDILSSDYYPASLLDAAFRVADDQSNRFTLPQAVKLVTKNPAQALNLQDRGVIGEGKRADLVLAHRKDNHIHIDHVWRQGKRVF
318 -> 318 Q

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0016810 - hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
biological_process GO:0019700 - organic phosphonate catabolic process
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Metcalf WW., et al., 1993
External database links:  
ECOCYC:
EG10722-MONOMER
ECOLIWIKI:
b4095
INTERPRO:
IPR011059
INTERPRO:
IPR032466
INTERPRO:
IPR013108
INTERPRO:
IPR012696
MODBASE:
P16689
PFAM:
PF07969
PRIDE:
P16689
REFSEQ:
NP_418519
SMR:
P16689
UNIPROT:
P16689


Operon      
Name: phnCDEFGHIJKLMNOP         
Operon arrangement:
Transcription unit        Promoter
phnCDEEFGHIJKLMNOP
phnLMNOP


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Metcalf WW., Wanner BL., 1993, Mutational analysis of an Escherichia coli fourteen-gene operon for phosphonate degradation, using TnphoA' elements., J Bacteriol 175(11):3430-42


RegulonDB