RegulonDB RegulonDB 10.9: Gene Form
   

phnO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

phnM phnP phnN phnO phnL

Gene      
Name: phnO    Texpresso search in the literature
Synonym(s): ECK4086, EG10724, b4093
Genome position(nucleotides): 4315104 <-- 4315538 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.93
External database links:  
ASAP:
ABE-0013415
CGSC:
34520
ECHOBASE:
EB0718
ECOLIHUB:
phnO
OU-MICROARRAY:
b4093
STRING:
511145.b4093
COLOMBOS: phnO


Product      
Name: aminoalkylphosphonate N-acetyltransferase
Synonym(s): PhnO
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.57
Isoelectric point: 6.504
Motif(s):
 
Type Positions Sequence
4 -> 144 CELRPATQYDTDAVYALICELKQAEFDHHAFRVGFNANLRDPNMRYHLALLDGEVVGMIGLHLQFHLHHVNWIGEIQELVVMPQARGLNVGSKLLAWAEEEARQAGAEMTELSTNVKRHDAHRFYLREGYEQSHFRFTKAL
24 -> 133 LKQAEFDHHAFRVGFNANLRDPNMRYHLALLDGEVVGMIGLHLQFHLHHVNWIGEIQELVVMPQARGLNVGSKLLAWAEEEARQAGAEMTELSTNVKRHDAHRFYLREGY

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0008080 - N-acetyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0061733 - peptide-lysine-N-acetyltransferase activity
biological_process GO:0018393 - internal peptidyl-lysine acetylation
GO:0033051 - aminophosphonate metabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG10724-MONOMER
ECOLIWIKI:
b4093
INTERPRO:
IPR000182
INTERPRO:
IPR016181
MODBASE:
P16691
PFAM:
PF00583
PRIDE:
P16691
PROSITE:
PS51186
REFSEQ:
NP_418517
SMR:
P16691
UNIPROT:
P16691


Operon      
Name: phnCDEFGHIJKLMNOP         
Operon arrangement:
Transcription unit        Promoter
phnCDEEFGHIJKLMNOP
phnLMNOP


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB