RegulonDB RegulonDB 10.8: Gene Form
   

phnP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

phnP phnO yjdP phnN

Gene      
Name: phnP    Texpresso search in the literature
Synonym(s): ECK4085, EG10725, b4092
Genome position(nucleotides): 4314344 <-- 4315102 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
59.29
External database links:  
ASAP:
ABE-0013412
CGSC:
34514
ECHOBASE:
EB0719
OU-MICROARRAY:
b4092
PortEco:
phnP
STRING:
511145.b4092
COLOMBOS: phnP


Product      
Name: 5-phospho-α-D-ribosyl 1,2-cyclic phosphate phosphodiesterase
Synonym(s): PhnP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.848
Isoelectric point: 6.364
Motif(s):
 
Type Positions Sequence
75 -> 75 T
70 -> 223 QQFLLTHYHMDHVQGLFPLRWGVGDPIPVYGPPDEQGCDDLFKHPGLLDFSHTVEPFVVFDLQGLQVTPLPLNHSKLTFGYLLETAHSRVAWLSDTAGLPEKTLKFLRNNQPQVMVMDCSHPPRADAPRNHCDLNTVLALNQVIRSPRVILTHI
200 -> 200 H
187 -> 187 D
222 -> 222 H

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0103043 - 5-phospho-alpha-D-ribosyl 1,2-cyclic phosphate phosphodiesterase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008081 - phosphoric diester hydrolase activity
GO:0030145 - manganese ion binding
GO:0042803 - protein homodimerization activity
biological_process GO:0019700 - organic phosphonate catabolic process
External database links:  
ECOCYC:
EG10725-MONOMER
ECOLIWIKI:
b4092
INTERPRO:
IPR036866
INTERPRO:
IPR001279
INTERPRO:
IPR017693
INTERPRO:
IPR035682
MODBASE:
P16692
PANTHER:
PTHR12553:SF21
PDB:
3G1P
PDB:
3P2U
PFAM:
PF12706
PRIDE:
P16692
PRODB:
PRO_000023539
REFSEQ:
NP_418516
SMART:
SM00849
SMR:
P16692
UNIPROT:
P16692


Operon      
Name: phnCDEFGHIJKLMNOP         
Operon arrangement:
Transcription unit        Promoter
phnCDEEFGHIJKLMNOP
phnLMNOP


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB