RegulonDB RegulonDB 10.8: Gene Form
   

pstS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glmS pstS pstC PhoB PhoB IHF TSS_4285 TSS_4285 TSS_4284 TSS_4284 TSS_4283 TSS_4283 TSS_4282 TSS_4282 TSS_4281 TSS_4281 pstSp pstSp pstCp pstCp

Gene      
Name: pstS    Texpresso search in the literature
Synonym(s): ECK3721, EG10734, R2pho, T, b3728, nmpA, phoR2a, phoS
Genome position(nucleotides): 3910485 <-- 3911525 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.49
External database links:  
ASAP:
ABE-0012190
CGSC:
17998
ECHOBASE:
EB0727
OU-MICROARRAY:
b3728
PortEco:
pstS
STRING:
511145.b3728
COLOMBOS: pstS


Shine dalgarno      
Sequence: tgaatcctccCAGGAGacatTAT


Product      
Name: phosphate ABC transporter periplasmic binding protein
Synonym(s): NmpA, PhoS, PiBP, PstS
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 37.024
Isoelectric point: 8.975
Motif(s):
 
Type Positions Sequence
1 -> 25 MKVMRTTVATVVAATLSMSAFSVFA
34 -> 36 ATF
164 -> 166 SGT
27 -> 307 ASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYK
166 -> 166 T

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0042301 - phosphate ion binding
biological_process GO:0010921 - regulation of phosphatase activity
GO:0006974 - cellular response to DNA damage stimulus
GO:0009314 - response to radiation
GO:0006817 - phosphate ion transport
GO:0035435 - phosphate ion transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Gerdes RG., et al., 1974
[2] Willsky GR., et al., 1976
External database links:  
DIP:
DIP-48241N
ECOCYC:
PSTS-MONOMER
ECOLIWIKI:
b3728
INTERPRO:
IPR024370
INTERPRO:
IPR005673
MINT:
MINT-1224444
MODBASE:
P0AG82
PDB:
1IXH
PDB:
1IXG
PDB:
1A55
PDB:
1A54
PDB:
1A40
PDB:
1IXI
PDB:
2ABH
PDB:
1OIB
PDB:
1PBP
PDB:
1QUI
PDB:
1QUJ
PDB:
1QUK
PDB:
1QUL
PFAM:
PF12849
PRIDE:
P0AG82
PRODB:
PRO_000023624
REFSEQ:
NP_418184
SMR:
P0AG82
SWISSMODEL:
P0AG82
UNIPROT:
P0AG82


Operon      
Name: pstSCAB-phoU         
Operon arrangement:
Transcription unit        Promoter
phoU
pstB-phoU
pstB-phoU
pstCAB-phoU
pstS
pstSCA
pstSCAB-phoU


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, IHF, PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4281 3912376 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4282 3912783 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4283 3912803 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4284 3913003 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4285 3913355 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gerdes RG., Rosenberg H., 1974, The relationship between the phosphate-binding protein and a regulator gene product from Escherichia coli., Biochim Biophys Acta 351(1):77-86

 [2] Willsky GR., Malamy MH., 1976, Control of the synthesis of alkaline phosphatase and the phosphate-binding protein in Escherichia coli., J Bacteriol 127(1):595-609

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB