RegulonDB RegulonDB 10.8: Gene Form
   

phoU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bglG pstB phoU LeuO LeuO RcsB-BglJ CRP Fis Fis H-NS anti-anti-terminator anti-terminator terminator anti-anti-terminator phoUp phoUp phoUp2 phoUp2 bglGp2 bglGp2 bglGp bglGp

Gene      
Name: phoU    Texpresso search in the literature
Synonym(s): ECK3717, EG10735, b3724, phoT, pst
Genome position(nucleotides): 3906853 <-- 3907578 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.62
External database links:  
ASAP:
ABE-0012177
CGSC:
18055
ECHOBASE:
EB0728
OU-MICROARRAY:
b3724
PortEco:
phoU
STRING:
511145.b3724
COLOMBOS: phoU


Product      
Name: negative regulator of the pho regulon
Synonym(s): PhoT, PhoU, Pst
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 27.417
Isoelectric point: 4.94
Motif(s):
 
Type Positions Sequence
27 -> 111 TMGGMVEQQLSDAITAMHNQDSDLAKRVIEGDKNVNMMEVAIDEACVRIIAKRQPTASDLRLVMVISKTIAELERIGDVADKICR
128 -> 212 LESLGRHTIQMLHDVLDAFARMDIDEAVRIYREDKKVDQEYEGIVRQLMTYMMEDSRTIPSVLTALFCARSIERIGDRCQNICEF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0019897 - extrinsic component of plasma membrane
molecular_function GO:0005515 - protein binding
GO:0000287 - magnesium ion binding
GO:0030145 - manganese ion binding
GO:0042803 - protein homodimerization activity
biological_process GO:0009267 - cellular response to starvation
GO:0001558 - regulation of cell growth
GO:0006817 - phosphate ion transport
GO:0009405 - pathogenesis
GO:0016036 - cellular response to phosphate starvation
GO:0010629 - negative regulation of gene expression
GO:0034605 - cellular response to heat
GO:0045936 - negative regulation of phosphate metabolic process
GO:0071467 - cellular response to pH
GO:0071236 - cellular response to antibiotic
GO:0030643 - cellular phosphate ion homeostasis
GO:0032413 - negative regulation of ion transmembrane transporter activity
GO:2000186 - negative regulation of phosphate transmembrane transport
External database links:  
DIP:
DIP-10503N
ECOCYC:
EG10735-MONOMER
ECOLIWIKI:
b3724
INTERPRO:
IPR026022
INTERPRO:
IPR038078
INTERPRO:
IPR028366
PANTHER:
PTHR42930:SF3
PFAM:
PF01895
PRIDE:
P0A9K7
PRODB:
PRO_000023547
REFSEQ:
NP_418180
SMR:
P0A9K7
UNIPROT:
P0A9K7


Operon      
Name: pstSCAB-phoU         
Operon arrangement:
Transcription unit        Promoter
phoU
pstB-phoU
pstB-phoU
pstCAB-phoU
pstS
pstSCA
pstSCAB-phoU


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, IHF, PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter phoUp2 3907646 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB