RegulonDB RegulonDB 10.9: Gene Form
   

pldA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

recQ pldA yigI LexA terminator recQp1 recQp1 recQp recQp recQp2 recQp2 pldAp pldAp TSS_4479 TSS_4479 yigIp yigIp rarDp5 rarDp5 rarDp3 rarDp3 rarDp4 rarDp4 rarDp2 rarDp2

Gene      
Name: pldA    Texpresso search in the literature
Synonym(s): ECK3815, EG10738, b3821
Genome position(nucleotides): 4004862 --> 4005731 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.26
Reference(s): [1] de Geus P., et al., 1983
External database links:  
ASAP:
ABE-0012479
CGSC:
384
ECHOBASE:
EB0731
ECOLIHUB:
pldA
OU-MICROARRAY:
b3821
STRING:
511145.b3821
COLOMBOS: pldA


Product      
Name: outer membrane phospholipase A
Synonym(s): OMPLA, PldA
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 33.163
Isoelectric point: 4.965
Motif(s):
 
Type Positions Sequence
85 -> 99 DEVKFQLSLAFPLWR
162 -> 162 H
204 -> 204 D
275 -> 286 NQTRVGVGVMLN
21 -> 289 QEATVKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYLIYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQLSNSEESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYTRLMAENGNWLVEVKPWYVVGNTDDNPDITKYMGYYQLKIGYHLGDAVLSAKGQYNWNTGYGGAELGLSYPITKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDLF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0031230 - intrinsic component of cell outer membrane
GO:0045203 - integral component of cell outer membrane
molecular_function GO:0102568 - phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine)
GO:0102567 - phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine)
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004620 - phospholipase activity
GO:0004622 - lysophospholipase activity
GO:0008970 - phospholipase A1 activity
GO:0004623 - phospholipase A2 activity
GO:0005509 - calcium ion binding
GO:0042803 - protein homodimerization activity
GO:0052739 - phosphatidylserine 1-acylhydrolase activity
GO:0052740 - 1-acyl-2-lysophosphatidylserine acylhydrolase activity
biological_process GO:0006629 - lipid metabolic process
GO:0016042 - lipid catabolic process
GO:0046471 - phosphatidylglycerol metabolic process
External database links:  
ECOCYC:
MONOMER0-341
ECOLIWIKI:
b3821
INTERPRO:
IPR036541
INTERPRO:
IPR003187
MODBASE:
P0A921
PANTHER:
PTHR40457
PDB:
1FW3
PDB:
1IM0
PDB:
1QD5
PDB:
1QD6
PDB:
1FW2
PDB:
1ILD
PDB:
1ILZ
PFAM:
PF02253
PRIDE:
P0A921
PRINTS:
PR01486
PRODB:
PRO_000023555
REFSEQ:
NP_418265
SMR:
P0A921
UNIPROT:
P0A921


Operon      
Name: pldA         
Operon arrangement:
Transcription unit        Promoter
pldA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rarDp2 4004231 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter rarDp4 4004241 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter rarDp3 4004258 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter rarDp5 4004297 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_4479 4004725 reverse nd [RS-EPT-CBR] [3]
  promoter recQp2 4005833 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter recQp1 4005858 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] de Geus P., van Die I., Bergmans H., Tommassen J., de Haas G., 1983, Molecular cloning of pldA, the structural gene for outer membrane phospholipase of E. coli K12., Mol Gen Genet 190(1):150-5

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB