RegulonDB RegulonDB 10.9: Gene Form
   

potA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pepT potA potB potC terminator pepTp pepTp TSS_1464 TSS_1464 TSS_1463 TSS_1463

Gene      
Name: potA    Texpresso search in the literature
Synonym(s): ECK1112, EG10749, b1126
Genome position(nucleotides): 1184458 <-- 1185594 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.84
External database links:  
ASAP:
ABE-0003796
CGSC:
31899
ECHOBASE:
EB0742
ECOLIHUB:
potA
OU-MICROARRAY:
b1126
STRING:
511145.b1126
COLOMBOS: potA


Product      
Name: spermidine preferential ABC transporter ATP binding subunit
Synonym(s): PotA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 43.028
Isoelectric point: 4.965
Motif(s):
 
Type Positions Sequence
135 -> 135 V
27 -> 27 F
292 -> 372 VLLRPEDLRVEEINDDNHAEGLIGYVRERNYKGMTLESVVELENGKMVMVSEFFNEDDPDFDHSLDQKMAINWVESWEVVL
26 -> 26 C
35 -> 174 QLDLTINNGEFLTLLGPSGCGKTTVLRLIAGLETVDSGRIMLDNEDITHVPAENRYVNTVFQSYALFPHMTVFENVAFGLRMQKTPAAEITPRVMEALRMVQLETFAQRKPHQLSGGQQQRVAIARAVVNKPRLLLLDES

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015417 - ATPase-coupled polyamine transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
GO:0015594 - ATPase-coupled putrescine transmembrane transporter activity
GO:0015595 - ATPase-coupled spermidine transmembrane transporter activity
biological_process GO:0015846 - polyamine transport
GO:0055085 - transmembrane transport
GO:0015847 - putrescine transport
GO:1903711 - spermidine transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
POTA-MONOMER
ECOLIWIKI:
b1126
INTERPRO:
IPR017879
INTERPRO:
IPR005893
INTERPRO:
IPR008995
INTERPRO:
IPR013611
INTERPRO:
IPR017871
INTERPRO:
IPR003439
INTERPRO:
IPR027417
INTERPRO:
IPR003593
MODBASE:
P69874
PFAM:
PF00005
PFAM:
PF08402
PRIDE:
P69874
PRODB:
PRO_000023567
PROSITE:
PS51305
PROSITE:
PS50893
PROSITE:
PS00211
REFSEQ:
NP_415644
SMART:
SM00382
SMR:
P69874
UNIPROT:
P69874


Operon      
Name: potABCD         
Operon arrangement:
Transcription unit        Promoter
potABCD


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1463 1185738 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1464 1185805 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB