RegulonDB RegulonDB 10.9: Gene Form
   

potB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

potA potD potB potC TSS_1462 (cluster) TSS_1462 (cluster) TSS_1461 TSS_1461 TSS_1460 TSS_1460 TSS_1459 TSS_1459 TSS_1458 TSS_1458 potDp6 potDp6 potDp5 potDp5 TSS_1457 TSS_1457 TSS_1456 TSS_1456

Gene      
Name: potB    Texpresso search in the literature
Synonym(s): ECK1111, EG10750, b1125
Genome position(nucleotides): 1183617 <-- 1184444 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.85
External database links:  
ASAP:
ABE-0003794
CGSC:
31902
ECHOBASE:
EB0743
ECOLIHUB:
potB
OU-MICROARRAY:
b1125
STRING:
511145.b1125
COLOMBOS: potB


Product      
Name: spermidine preferential ABC transporter membrane subunit PotB
Synonym(s): PotB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 31.062
Isoelectric point: 9.809
Motif(s):
 
Type Positions Sequence
61 -> 81 MALIATLACLVLGYPFAWFLA
73 -> 272 GYPFAWFLAKLPHKVRPLLLFLLIVPFWTNSLIRIYGLKIFLSTKGYLNEFLLWLGVIDTPIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARDLGASKLQTFIRIIIPLTMPGIIAGCLLVMLPAMGLFYVSDLMGGAKNLLIGNVIKVQFLNIRDWPFGAATSITLTIVMGLMLLVYWRASRLLNKKV
90 -> 110 LLLFLLIVPFWTNSLIRIYGL
136 -> 156 IMFTPSAVIIGLVYILLPFMV
242 -> 262 FGAATSITLTIVMGLMLLVYW

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0015595 - ATPase-coupled spermidine transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
GO:0015847 - putrescine transport
GO:1903711 - spermidine transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
POTB-MONOMER
ECOLIWIKI:
b1125
INTERPRO:
IPR000515
INTERPRO:
IPR035906
PFAM:
PF00528
PRIDE:
P0AFK4
PRODB:
PRO_000023568
PROSITE:
PS50928
REFSEQ:
NP_415643
UNIPROT:
P0AFK4


Operon      
Name: potABCD         
Operon arrangement:
Transcription unit        Promoter
potABCD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1456 1182741 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1457 1182847 reverse nd [RS-EPT-CBR] [1]
  promoter potDp5 1182848 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter potDp6 1182850 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1458 1182851 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1459 1182909 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1460 1182913 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1461 1182965 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1462 (cluster) 1182969 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB