RegulonDB RegulonDB 10.9: Gene Form
   

ppiA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tsgA ppiA yhfG fic CRP CRP CytR CytR NsrR CRP CpxR terminator tsgAp tsgAp ppiAp4 ppiAp4 ppiAp3 ppiAp3 ppiAp2 ppiAp2 ppiAp1 ppiAp1 yhfGp yhfGp

Gene      
Name: ppiA    Texpresso search in the literature
Synonym(s): ECK3351, EG10757, b3363, rot, rotA
Genome position(nucleotides): 3491725 <-- 3492297 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.13
External database links:  
ASAP:
ABE-0010992
CGSC:
31121
ECHOBASE:
EB0750
ECOLIHUB:
ppiA
OU-MICROARRAY:
b3363
STRING:
511145.b3363
COLOMBOS: ppiA


Product      
Name: peptidyl-prolyl cis-trans isomerase A
Synonym(s): PpiA, Rot, RotA, rotamase A
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 20.431
Isoelectric point: 9.385
Motif(s):
 
Type Positions Sequence
1 -> 24 MFKSTLAAMAAVFALSALSPAAMA
27 -> 188 GDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKV
136 -> 136 F
25 -> 190 AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP
31 -> 188 VLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKV

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0016853 - isomerase activity
GO:0003755 - peptidyl-prolyl cis-trans isomerase activity
biological_process GO:0006457 - protein folding
GO:0000413 - protein peptidyl-prolyl isomerization
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48080N
ECOCYC:
EG10757-MONOMER
ECOLIWIKI:
b3363
INTERPRO:
IPR020892
INTERPRO:
IPR002130
INTERPRO:
IPR029000
MODBASE:
P0AFL3
PDB:
1VAI
PDB:
1V9T
PDB:
1J2A
PDB:
1CLH
PFAM:
PF00160
PRIDE:
P0AFL3
PRINTS:
PR00153
PROSITE:
PS50072
PROSITE:
PS00170
REFSEQ:
NP_417822
SMR:
P0AFL3
SWISSMODEL:
P0AFL3
UNIPROT:
P0AFL3


Operon      
Name: ppiA         
Operon arrangement:
Transcription unit        Promoter
ppiA
ppiA
ppiA
ppiA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, CpxR
Repressed by: CRP, CytR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB