RegulonDB RegulonDB 10.9: Gene Form
   

prc gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

prc htpX proQ terminator prcp1 prcp1 TSS_2178 TSS_2178 TSS_2177 TSS_2177 htpXp htpXp TSS_2175 TSS_2175

Gene      
Name: prc    Texpresso search in the literature
Synonym(s): ECK1829, EG10760, b1830, tsp
Genome position(nucleotides): 1912768 <-- 1914816 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.37
External database links:  
ASAP:
ABE-0006090
CGSC:
32334
ECHOBASE:
EB0753
ECOLIHUB:
prc
MIM:
615233
OU-MICROARRAY:
b1830
STRING:
511145.b1830
COLOMBOS: prc


Product      
Name: tail-specific protease
Synonym(s): Prc, Tsp, c-terminal processing peptidase, protease Re
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 76.663
Isoelectric point: 6.453
Motif(s):
 
Type Positions Sequence
463 -> 463 D
536 -> 667 ETETGEKFEDNALPWDSIDAATYVKSGDLTAFEPELLKEHNARIAKDPEFQNIMKDIARFNAMKDKRNIVSLNYAVREKENNEDDATRLARLNERFKREGKPELKKLDDLPKDYQEPDPYLDETVNIALDLA
23 -> 682 VEDITRADQIPVLKEETQHATVSERVTSRFTRSHYRQFDLDQAFSAKIFDRYLNLLDYSHNVLLASDVEQFAKKKTELGDELRSGKLDVFYDLYNLAQKRRFERYQYALSVLEKPMDFTGNDTYNLDRSKAPWPKNEAELNALWDSKVKFDELSLKLTGKTDKEIRETLTRRYKFAIRRLAQTNSEDVFSLAMTAFAREIDPHTNYLSPRNTEQFNTEMSLSLEGIGAVLQMDDDYTVINSMVAGGPAAKSKAISVGDKIVGVGQTGKPMVDVIGWRLDDVVALIKGPKGSKVRLEILPAGKGTKTRTVTLTRERIRLEDRAVKMSVKTVGKEKVGVLDIPGFYVGLTDDVKVQLQKLEKQNVSSVIIDLRSNGGGALTEAVSLSGLFIPAGPIVQVRDNNGKVREDSDTDGQVFYKGPLVVLVDRFSASASEIFAAAMQDYGRALVVGEPTFGKGTVQQYRSLNRIYDQMLRPEWPALGSVQYTIQKFYRVNGGSTQRKGVTPDIIMPTGNEETETGEKFEDNALPWDSIDAATYVKSGDLTAFEPELLKEHNARIAKDPEFQNIMKDIARFNAMKDKRNIVSLNYAVREKENNEDDATRLARLNERFKREGKPELKKLDDLPKDYQEPDPYLDETVNIALDLAKLEKARPAEQPAPVK
356 -> 529 KVGVLDIPGFYVGLTDDVKVQLQKLEKQNVSSVIIDLRSNGGGALTEAVSLSGLFIPAGPIVQVRDNNGKVREDSDTDGQVFYKGPLVVLVDRFSASASEIFAAAMQDYGRALVVGEPTFGKGTVQQYRSLNRIYDQMLRPEWPALGSVQYTIQKFYRVNGGSTQRKGVTPDII
398 -> 398 G

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  2 - information transfer --> 2.3 - protein related --> 2.3.6 - turnover, degradation
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
molecular_function GO:0005515 - protein binding
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0004175 - endopeptidase activity
GO:0004252 - serine-type endopeptidase activity
GO:0008236 - serine-type peptidase activity
biological_process GO:0006508 - proteolysis
GO:0030163 - protein catabolic process
GO:0046677 - response to antibiotic
GO:0007165 - signal transduction
Note(s): Note(s): ...[more].
Reference(s): [1] Chen C., et al., 2004
[2] Lee YS., et al., 1988
[3] Lykkemark S., et al., 2014
[4] Roseman JE., et al., 1987
[5] Tadokoro A., et al., 2004
External database links:  
DIP:
DIP-10557N
ECOCYC:
EG10760-MONOMER
ECOLIWIKI:
b1830
ECOO157CYC:
PRC-MONOMER
INTERPRO:
IPR040573
INTERPRO:
IPR020992
INTERPRO:
IPR036034
INTERPRO:
IPR001478
INTERPRO:
IPR004447
INTERPRO:
IPR005151
INTERPRO:
IPR029045
MODBASE:
P23865
PDB:
6IQU
PDB:
6IQS
PDB:
6IQR
PDB:
6IQQ
PDB:
5WQL
PFAM:
PF00595
PFAM:
PF17804
PFAM:
PF11818
PFAM:
PF03572
PRIDE:
P23865
PRODB:
PRO_000023587
PROSITE:
PS50106
REFSEQ:
NP_416344
SMART:
SM00245
SMART:
SM00228
SMR:
P23865
UNIPROT:
P23865


Operon      
Name: proQ-prc         
Operon arrangement:
Transcription unit        Promoter
proQ-prc


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2175 1912259 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_2177 1913805 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_2178 1914229 reverse nd [RS-EPT-CBR] [6]
  promoter prcp1 1915027 reverse Similarity to the consensus
Read more >
[ICWHO] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Chen C., Snedecor B., Nishihara JC., Joly JC., McFarland N., Andersen DC., Battersby JE., Champion KM., 2004, High-level accumulation of a recombinant antibody fragment in the periplasm of Escherichia coli requires a triple-mutant (degP prc spr) host strain., Biotechnol Bioeng 85(5):463-74

 [2] Lee YS., Park SC., Goldberg AL., Chung CH., 1988, Protease So from Escherichia coli preferentially degrades oxidatively damaged glutamine synthetase., J Biol Chem 263(14):6643-6

 [3] Lykkemark S., Mandrup OA., Friis NA., Kristensen P., 2014, Degradation of C-terminal tag sequences on domain antibodies purified from E. coli supernatant., MAbs 6(6):1551-9

 [4] Roseman JE., Levine RL., 1987, Purification of a protease from Escherichia coli with specificity for oxidized glutamine synthetase., J Biol Chem 262(5):2101-10

 [5] Tadokoro A., Hayashi H., Kishimoto T., Makino Y., Fujisaki S., Nishimura Y., 2004, Interaction of the Escherichia coli lipoprotein NlpI with periplasmic Prc (Tsp) protease., J Biochem (Tokyo) 135(2):185-91

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB