RegulonDB RegulonDB 10.8: Gene Form
   

prc gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

prc htpX proQ terminator prcp1 prcp1 TSS_2178 TSS_2178 TSS_2177 TSS_2177 htpXp htpXp TSS_2175 TSS_2175

Gene      
Name: prc    Texpresso search in the literature
Synonym(s): ECK1829, EG10760, b1830, tsp
Genome position(nucleotides): 1912768 <-- 1914816 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.37
External database links:  
ASAP:
ABE-0006090
CGSC:
32334
ECHOBASE:
EB0753
MIM:
615233
OU-MICROARRAY:
b1830
PortEco:
prc
STRING:
511145.b1830
COLOMBOS: prc


Product      
Name: tail-specific protease
Synonym(s): Prc, Tsp, c-terminal processing peptidase, carboxy-terminal protease for penicillin-binding protein 3, protease re
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 76.663
Isoelectric point: 6.453
Motif(s):
 
Type Positions Sequence
463 -> 463 D
536 -> 667 ETETGEKFEDNALPWDSIDAATYVKSGDLTAFEPELLKEHNARIAKDPEFQNIMKDIARFNAMKDKRNIVSLNYAVREKENNEDDATRLARLNERFKREGKPELKKLDDLPKDYQEPDPYLDETVNIALDLA
23 -> 682 VEDITRADQIPVLKEETQHATVSERVTSRFTRSHYRQFDLDQAFSAKIFDRYLNLLDYSHNVLLASDVEQFAKKKTELGDELRSGKLDVFYDLYNLAQKRRFERYQYALSVLEKPMDFTGNDTYNLDRSKAPWPKNEAELNALWDSKVKFDELSLKLTGKTDKEIRETLTRRYKFAIRRLAQTNSEDVFSLAMTAFAREIDPHTNYLSPRNTEQFNTEMSLSLEGIGAVLQMDDDYTVINSMVAGGPAAKSKAISVGDKIVGVGQTGKPMVDVIGWRLDDVVALIKGPKGSKVRLEILPAGKGTKTRTVTLTRERIRLEDRAVKMSVKTVGKEKVGVLDIPGFYVGLTDDVKVQLQKLEKQNVSSVIIDLRSNGGGALTEAVSLSGLFIPAGPIVQVRDNNGKVREDSDTDGQVFYKGPLVVLVDRFSASASEIFAAAMQDYGRALVVGEPTFGKGTVQQYRSLNRIYDQMLRPEWPALGSVQYTIQKFYRVNGGSTQRKGVTPDIIMPTGNEETETGEKFEDNALPWDSIDAATYVKSGDLTAFEPELLKEHNARIAKDPEFQNIMKDIARFNAMKDKRNIVSLNYAVREKENNEDDATRLARLNERFKREGKPELKKLDDLPKDYQEPDPYLDETVNIALDLAKLEKARPAEQPAPVK
356 -> 529 KVGVLDIPGFYVGLTDDVKVQLQKLEKQNVSSVIIDLRSNGGGALTEAVSLSGLFIPAGPIVQVRDNNGKVREDSDTDGQVFYKGPLVVLVDRFSASASEIFAAAMQDYGRALVVGEPTFGKGTVQQYRSLNRIYDQMLRPEWPALGSVQYTIQKFYRVNGGSTQRKGVTPDII
398 -> 398 G

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  2 - information transfer --> 2.3 - protein related --> 2.3.6 - turnover, degradation
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
  6 - cell structure --> 6.2 - murein
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
molecular_function GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0004175 - endopeptidase activity
GO:0008236 - serine-type peptidase activity
biological_process GO:0006508 - proteolysis
GO:0030163 - protein catabolic process
GO:0046677 - response to antibiotic
GO:0007165 - signal transduction
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10557N
ECOCYC:
EG10760-MONOMER
ECOLIWIKI:
b1830
ECOO157CYC:
PRC-MONOMER
INTERPRO:
IPR005151
INTERPRO:
IPR004447
INTERPRO:
IPR001478
INTERPRO:
IPR040573
INTERPRO:
IPR029045
INTERPRO:
IPR020992
INTERPRO:
IPR036034
MINT:
MINT-1283244
MODBASE:
P23865
PDB:
6IQU
PDB:
6IQS
PDB:
6IQQ
PDB:
5WQL
PDB:
6IQR
PFAM:
PF03572
PFAM:
PF17804
PFAM:
PF00595
PFAM:
PF11818
PRIDE:
P23865
PRODB:
PRO_000023587
PROSITE:
PS50106
REFSEQ:
NP_416344
SMART:
SM00245
SMART:
SM00228
SMR:
P23865
UNIPROT:
P23865


Operon      
Name: proQ-prc         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2175 1912259 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2177 1913805 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2178 1914229 reverse nd [RS-EPT-CBR] [1]
  promoter prcp1 1915027 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB