RegulonDB RegulonDB 10.9: Gene Form
   

proA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

proA proB thrW Fis thrWp thrWp TSS_464 TSS_464 TSS_463 TSS_463 TSS_462 TSS_462

Gene      
Name: proA    Texpresso search in the literature
Synonym(s): ECK0244, EG10767, b0243, pro(1), pro1
Genome position(nucleotides): 261503 --> 262756 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.31
External database links:  
ASAP:
ABE-0000832
CGSC:
364
ECHOBASE:
EB0760
ECOLIHUB:
proA
MIM:
219150
MIM:
601162
MIM:
616586
MIM:
616603
OU-MICROARRAY:
b0243
STRING:
511145.b0243
COLOMBOS: proA


Product      
Name: glutamate-5-semialdehyde dehydrogenase
Synonym(s): ProA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 44.63
Isoelectric point: 5.321
Motif(s):
 
Type Positions Sequence
8 -> 282 AAKQASYKLAQLSSREKNRVLEKIADELEAQSEIILNANAQDVADARANGLSEAMLDRLALTPARLKGIADDVRQVCNLADPVGQVIDGGVLDSGLRLERRRVPLGVIGVIYEARPNVTVDVASLCLKTGNAVILRGGKETCRTNAATVAVIQDALKSCGLPAGAVQAIDNPDRALVSEMLRMDKYIDMLIPRGGAGLHKLCREQSTIPVITGGIGVCHIYVDESVEIAEALKVIVNAKTQRPSTCNTVETLLVNKNIADSFLPALSKQMAESGV
358 -> 367 EVDSSAVYVN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.4 - proline
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016491 - oxidoreductase activity
GO:0016620 - oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0004350 - glutamate-5-semialdehyde dehydrogenase activity
GO:0042802 - identical protein binding
GO:0050661 - NADP binding
biological_process GO:0006561 - proline biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0055114 - oxidation-reduction process
GO:0055129 - L-proline biosynthetic process
External database links:  
DIP:
DIP-10568N
ECOCYC:
GLUTSEMIALDEHYDROG-MONOMER
ECOLIWIKI:
b0243
INTERPRO:
IPR015590
INTERPRO:
IPR020593
INTERPRO:
IPR016163
INTERPRO:
IPR016162
INTERPRO:
IPR016161
INTERPRO:
IPR012134
INTERPRO:
IPR000965
MODBASE:
P07004
PFAM:
PF00171
PRIDE:
P07004
PRODB:
PRO_000023596
PROSITE:
PS01223
REFSEQ:
NP_414778
SMR:
P07004
SWISSMODEL:
P07004
UNIPROT:
P07004


Operon      
Name: proBA         
Operon arrangement:
Transcription unit        Promoter
proBA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_462 260569 forward nd [RS-EPT-CBR] [1]
  promoter TSS_463 261229 forward nd [RS-EPT-CBR] [1]
  promoter TSS_464 261423 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB