RegulonDB RegulonDB 10.9: Gene Form
   

prs gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dauA prs ispE PurR anti-anti-terminator anti-terminator terminator prsp prsp TSS_1540 TSS_1540 TSS_1539 TSS_1539 TSS_1538 TSS_1538 TSS_1537 TSS_1537

Gene      
Name: prs    Texpresso search in the literature
Synonym(s): ECK1195, EG10774, b1207, dnaR, prsA
Genome position(nucleotides): 1260928 <-- 1261875 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.53
External database links:  
ASAP:
ABE-0004054
CGSC:
357
ECHOBASE:
EB0767
ECOLIHUB:
prs
ECOO157CYC:
PRSA
OU-MICROARRAY:
b1207
STRING:
511145.b1207
COLOMBOS: prs


Product      
Name: ribose-phosphate diphosphokinase
Synonym(s): DnaR, Prs, PrsA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.218
Isoelectric point: 5.054
Motif(s):
 
Type Positions Sequence
4 -> 121 MKLFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTCAPTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSVG
221 -> 221 D
2 -> 315 PDMKLFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTCAPTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSVGVDRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQLNLDNPIVVSPDIGGVVRARAIAKLLNDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFSGNAANNLRNSVIDEVVVCDTIPLSDEIKSLPNVRTLTLSGMLAEAIRRISNEESISAMFEH
127 -> 127 T
96 -> 97 RQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.3 - purine ribonucleotide biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0002189 - ribose phosphate diphosphokinase complex
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004749 - ribose phosphate diphosphokinase activity
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
GO:0043531 - ADP binding
GO:0042301 - phosphate ion binding
biological_process GO:0008152 - metabolic process
GO:0006164 - purine nucleotide biosynthetic process
GO:0009116 - nucleoside metabolic process
GO:0009165 - nucleotide biosynthetic process
GO:0044249 - cellular biosynthetic process
GO:0016310 - phosphorylation
GO:0009156 - ribonucleoside monophosphate biosynthetic process
GO:0006015 - 5-phosphoribose 1-diphosphate biosynthetic process
GO:0034214 - protein hexamerization
External database links:  
DIP:
DIP-35839N
ECOCYC:
PRPPSYN-MONOMER
ECOLIWIKI:
b1207
INTERPRO:
IPR037515
INTERPRO:
IPR029099
INTERPRO:
IPR000836
INTERPRO:
IPR000842
INTERPRO:
IPR005946
INTERPRO:
IPR029057
PANTHER:
PTHR10210
PDB:
4S2U
PFAM:
PF13793
PFAM:
PF14572
PRIDE:
P0A717
PRODB:
PRO_000023611
PROSITE:
PS00114
REFSEQ:
NP_415725
SMR:
P0A717
SWISSMODEL:
P0A717
UNIPROT:
P0A717


Operon      
Name: lolB-ispE-prs         
Operon arrangement:
Transcription unit        Promoter
prs
lolB-ispE-prs


Transcriptional Regulation      
Display Regulation             
Repressed by: PurR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1537 1259525 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1538 1260982 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1539 1261162 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1540 1261821 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB