RegulonDB RegulonDB 10.9: Gene Form
   

pspB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pspA pspC pspB pspD

Gene      
Name: pspB    Texpresso search in the literature
Synonym(s): ECK1300, EG10777, b1305
Genome position(nucleotides): 1368801 --> 1369025 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.56
External database links:  
ASAP:
ABE-0004389
CGSC:
32012
ECHOBASE:
EB0770
ECOLIHUB:
pspB
OU-MICROARRAY:
b1305
STRING:
511145.b1305
COLOMBOS: pspB


Product      
Name: phage shock protein B
Synonym(s): PspB, phage shock protein B / antitoxin of a putative PspC-PspB toxin-antitoxin pair
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 8.763
Isoelectric point: 7.702
Motif(s):
 
Type Positions Sequence
4 -> 24 LFLAIPLTIFVLFVLPIWLWL
3 -> 73 ALFLAIPLTIFVLFVLPIWLWLHYSNRSGRSELSQSEQQRLAQLADEAKRMRERIQALESILDAEHPNWRD

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0009271 - phage shock
Note(s): Note(s): ...[more].
Evidence: [AS] Author statement
[IE] Inferred from experiment
Reference(s): [1] Brown JM., et al., 2003
[2] Weiner L., et al., 1991
External database links:  
DIP:
DIP-10588N
ECOCYC:
EG10777-MONOMER
ECOLIWIKI:
b1305
INTERPRO:
IPR009554
PFAM:
PF06667
PRIDE:
P0AFM9
PRODB:
PRO_000023615
REFSEQ:
NP_415821
UNIPROT:
P0AFM9


Operon      
Name: pspABCDE         
Operon arrangement:
Transcription unit        Promoter
pspABCDE
pspBCDE
pspE


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, PspF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Brown JM., Shaw KJ., 2003, A novel family of Escherichia coli toxin-antitoxin gene pairs., J Bacteriol 185(22):6600-8

 [2] Weiner L., Brissette JL., Model P., 1991, Stress-induced expression of the Escherichia coli phage shock protein operon is dependent on sigma 54 and modulated by positive and negative feedback mechanisms., Genes Dev 5(10):1912-23


RegulonDB