RegulonDB RegulonDB 10.9: Gene Form
   

pspD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pspC pspE pspD anti-terminator anti-anti-terminator terminator ycjMp4 ycjMp4 TSS_1743 TSS_1743

Gene      
Name: pspD    Texpresso search in the literature
Synonym(s): ECK1302, EG10779, b1307
Genome position(nucleotides): 1369393 --> 1369614 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.5
External database links:  
ASAP:
ABE-0004394
ECHOBASE:
EB0772
ECOLIHUB:
pspD
OU-MICROARRAY:
b1307
STRING:
511145.b1307
COLOMBOS: pspD


Product      
Name: phage shock protein D
Synonym(s): PspD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 8.042
Isoelectric point: 12.427
Motif(s):
 
Type Positions Sequence
11 -> 71 KVKPGFKLAGKLVLLTALRYGPAGVAGWAIKSVARRPLKMLLAVALEPLLSRAANKLAQRY

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0016020 - membrane
GO:0005886 - plasma membrane
biological_process GO:0009271 - phage shock
Note(s): Note(s): ...[more].
Evidence: [IEP] Inferred from expression pattern
Reference(s): [1] Brissette JL., et al., 1991
External database links:  
ECOCYC:
EG10779-MONOMER
ECOLIWIKI:
b1307
INTERPRO:
IPR014321
PFAM:
PF09584
PRIDE:
P0AFV8
PRODB:
PRO_000023617
REFSEQ:
NP_415823
SMR:
P0AFV8
UNIPROT:
P0AFV8


Operon      
Name: pspABCDE         
Operon arrangement:
Transcription unit        Promoter
pspABCDE
pspBCDE
pspE


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, PspF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1743 1369662 forward nd [RS-EPT-CBR] [2]
  promoter ycjMp4 1370003 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Brissette JL., Weiner L., Ripmaster TL., Model P., 1991, Characterization and sequence of the Escherichia coli stress-induced psp operon., J Mol Biol 220(1):35-48

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB